Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $1,326,995.67
PubMed Score 33.57
PubTator Score 12.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.086 0.007
glioblastoma 1.300 0.001
ovarian cancer 1.700 0.000

Synonym

Accession Q9GZP9 Q9Y3A7
Symbols FLANa
F-LANa
CGI-101
F-LAN-1
derlin-2
DERtrin-2

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
26107514 specific silencing of Derlin-2, p97 and HRD1 by shRNAs increases steady state levels of proinsulin. these ERAD constituents are critically involved in proinsulin degradation and may therefore also play a role in subsequent antigen generation.
23867461 derlin2 functions with HRD1 in ERAD of certain substrates independent of their glycosylation status.
16912321 Required for Polyoma virus infection.
16449189 Findings indicate that Derlin-2 provides the missing link between EDEM and p97 in the process of degrading misfolded glycoproteins.
16186509 Derlin-2 forms a robust multiprotein complex with the p97 AAA ATPase as well as the mammalian orthologs of the yeast Hrd1p/Hrd3p ubiquitin-ligase complex, and participates in the degradation of proteins from the ER.

AA Sequence

MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN      1 - 70
FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVR     71 - 140
MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFD    141 - 210
TPDEDPNYNPLPEERPGGFAWGEGQRLGG                                             211 - 239
//

Text Mined References (19)

PMID Year Title
26107514 2015 Proteasomal Degradation of Proinsulin Requires Derlin-2, HRD1 and p97.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25416956 2014 A proteome-scale map of the human interactome network.
23867461 2013 Derlin2 protein facilitates HRD1-mediated retro-translocation of sonic hedgehog at the endoplasmic reticulum.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
19946888 2010 Defining the membrane proteome of NK cells.
19084021 2009 Mammalian OS-9 is upregulated in response to endoplasmic reticulum stress and facilitates ubiquitination of misfolded glycoproteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16912321 2006 Murine polyomavirus requires the endoplasmic reticulum protein Derlin-2 to initiate infection.
16449194 2006 Neuronal cotransport of glycine receptor and the scaffold protein gephyrin.
More...