Property Summary

NCBI Gene PubMed Count 18
PubMed Score 43.89
PubTator Score 12.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.8e-04
glioblastoma 5792 1.1e-03
osteosarcoma 7950 6.9e-03
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis type 6 3 3.894 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.300 1.1e-03
osteosarcoma -1.086 6.9e-03
ovarian cancer 1.700 1.8e-04

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN      1 - 70
FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVR     71 - 140
MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFD    141 - 210
TPDEDPNYNPLPEERPGGFAWGEGQRLGG                                             211 - 239
//

Text Mined References (20)

PMID Year Title