Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.83
PubTator Score 7.70

Knowledge Summary

Patent (701)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (4)

PMID Text
22355687 Structure and function analyses of the purified GPCR human vomeronasal type 1 receptor 1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17627382 Observational study of genotype prevalence. (HuGE Navigator)
17627382 The human VN1R1 gene are unlikely to be associated with gender and hence to contribute to distinct gender-specific behavior.

AA Sequence

MVGDTLKLLSPLMTRYFFLLFYSTDSSDLNENQHPLDFDEMAFGKVKSGISFLIQTGVGILGNSFLLCFY      1 - 70
NLILFTGHKLRPTDLILSQLALANSMVLFFKGIPQTMAAFGLKYLLNDTGCKFVFYYHRVGTRVSLSTIC     71 - 140
LLNGFQAIKLNPSICRWMEIKIRSPRFIDFCCLLCWAPHVLMNASVLLLVNGPLNSKNSSAKNNYGYCSY    141 - 210
KASKRFSSLHAVLYFSPDFMSLGFMVWASGSMVFFLYRHKQQVQHNHSNRLSCRPSQEARATHTIMVLVS    211 - 280
SFFVFYSVHSFLTIWTTVVANPGQWIVTNSVLVASCFPARSPFVLIMSDTHISQFCFACRTRKTLFPNLV    281 - 350
VMP                                                                       351 - 353
//

Text Mined References (12)

PMID Year Title
22355687 2011 Structure and function analyses of the purified GPCR human vomeronasal type 1 receptor 1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19952141 2010 Extreme variability among mammalian V1R gene families.
17627382 2007 Association study of human VN1R1 pheromone receptor gene alleles and gender.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12826614 2003 Evolutionary deterioration of the vomeronasal pheromone transduction pathway in catarrhine primates.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11163270 2000 A novel family of candidate pheromone receptors in mammals.
More...