Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.13
PubTator Score 7.70

Knowledge Summary

Patent (701)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.1e-25
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.1e-25

Gene RIF (5)

AA Sequence

MVGDTLKLLSPLMTRYFFLLFYSTDSSDLNENQHPLDFDEMAFGKVKSGISFLIQTGVGILGNSFLLCFY      1 - 70
NLILFTGHKLRPTDLILSQLALANSMVLFFKGIPQTMAAFGLKYLLNDTGCKFVFYYHRVGTRVSLSTIC     71 - 140
LLNGFQAIKLNPSICRWMEIKIRSPRFIDFCCLLCWAPHVLMNASVLLLVNGPLNSKNSSAKNNYGYCSY    141 - 210
KASKRFSSLHAVLYFSPDFMSLGFMVWASGSMVFFLYRHKQQVQHNHSNRLSCRPSQEARATHTIMVLVS    211 - 280
SFFVFYSVHSFLTIWTTVVANPGQWIVTNSVLVASCFPARSPFVLIMSDTHISQFCFACRTRKTLFPNLV    281 - 350
VMP                                                                       351 - 353
//

Text Mined References (13)

PMID Year Title