Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.56
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 5.9e-04
astrocytic glioma -1.500 3.8e-02
atypical teratoid / rhabdoid tumor -1.300 8.6e-04
glioblastoma -1.200 5.7e-05
medulloblastoma -1.200 1.0e-06
medulloblastoma, large-cell -1.400 3.2e-06
oligodendroglioma -1.600 4.2e-02
osteosarcoma -2.007 1.5e-04
pancreatic cancer -1.200 1.1e-03
pancreatic carcinoma -1.200 1.1e-03
Pick disease -1.200 1.6e-04

Synonym

Accession Q9GZP4 B2R7J4 Q5QPN6 Q5QPN7 Q9NRI8
Symbols HT014
TXNL1CL
C1orf128

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEERTDRSKFVES      1 - 70
DADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYA     71 - 140
TKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFI    141 - 210
S//

Text Mined References (13)

PMID Year Title