Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.56
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer -1.200 0.001
astrocytic glioma -1.500 0.038
oligodendroglioma -1.600 0.042
osteosarcoma -2.007 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.700 0.001
pancreatic carcinoma -1.200 0.001
Pick disease -1.200 0.000

Gene RIF (1)

PMID Text
25134913 PITHD1 was a novel activator of IRES and enhanced RUNX1 expression that subsequently promoted megakaryocyte differentiation.

AA Sequence

MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEERTDRSKFVES      1 - 70
DADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYA     71 - 140
TKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFI    141 - 210
S//

Text Mined References (13)

PMID Year Title
25134913 2015 Novel function of PITH domain-containing 1 as an activator of internal ribosomal entry site to enhance RUNX1 expression and promote megakaryocyte differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...