Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.28
PubTator Score 2.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.011 3.1e-03
psoriasis 1.100 7.7e-04
atypical teratoid / rhabdoid tumor -1.100 3.6e-04
lung cancer 2.400 1.3e-03
Parkinson's disease -1.100 3.1e-02
ovarian cancer -2.000 1.3e-06
dermatomyositis 1.100 2.6e-03

Synonym

Accession Q9GZN1 B3KW37 B4DLG9 Q53GH2 Q9BY39 Q9H8H6 hArp6
Symbols ARP6
CDA12
hARP6
hARPX
HSPC281
MSTP136

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26164235 under starvation, ARP6 was required for cell survival through the repression of rDNA transcription independently of H2A.Z
16487625 Results describe the predominant nuclear localization of another Arp subfamily, Arp6, in vertebrate cells, and show its colocalization with heterochromatin protein 1 orthologs in pericentric heterochromatin.

AA Sequence

MTTLVLDNGAYNAKIGYSHENVSVIPNCQFRSKTARLKTFTANQIDEIKDPSGLFYILPFQKGYLVNWDV      1 - 70
QRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQFQAVLRVNAGALSAHRYFRDNP     71 - 140
SELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVC    141 - 210
YVSQDFYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEI    211 - 280
LFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSLFPGFRDRVYSEVRCLTPTDYDVSVV    281 - 350
LPENPITYAWEGGKLISENDDFEDMVVTREDYEENGHSVCEEKFDI                            351 - 396
//

Text Mined References (14)

PMID Year Title
26164235 2015 The actin family protein ARP6 contributes to the structure and the function of the nucleolus.
20473270 2010 Essential role of p18Hamlet/SRCAP-mediated histone H2A.Z chromatin incorporation in muscle differentiation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16487625 2006 Vertebrate Arp6, a novel nuclear actin-related protein, interacts with heterochromatin protein 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11368909 2001 Novel actin-related proteins in vertebrates: similarities of structure and expression pattern to Arp6 localized on Drosophila heterochromatin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.