Property Summary

NCBI Gene PubMed Count 70
PubMed Score 70.78
PubTator Score 66.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia 1.200 2.7e-02
adrenocortical carcinoma -1.374 7.3e-05
adult high grade glioma -1.500 7.5e-05
astrocytic glioma -1.800 2.6e-03
Astrocytoma, Pilocytic -1.600 7.3e-08
atypical teratoid / rhabdoid tumor -1.600 1.0e-07
ependymoma -1.300 2.0e-08
glioblastoma -1.300 1.7e-07
group 4 medulloblastoma -1.600 7.5e-06
lung adenocarcinoma -1.100 3.8e-13
medulloblastoma, large-cell -2.800 3.5e-05
oligodendroglioma -1.300 1.7e-02
ovarian cancer 1.300 2.8e-03
primitive neuroectodermal tumor -1.300 6.5e-04
subependymal giant cell astrocytoma -1.182 3.4e-02

Gene RIF (41)

AA Sequence

MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ      1 - 70
RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE     71 - 140
QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV    141 - 210
QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ    211 - 280
ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV         281 - 345
//

Text Mined References (76)

PMID Year Title