Property Summary

NCBI Gene PubMed Count 64
Grant Count 82
R01 Count 60
Funding $9,330,024.62
PubMed Score 67.59
PubTator Score 66.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q9GZM8 B3KP93 D3DTS0 J3QT32 Q86T80 Q8TAR7 Q9UH50 Protein Nudel
Symbols EOPA
NDE2
NUDEL
MITAP1
NDE1L1

Gene

PDB

2V66  

Gene RIF (39)

PMID Text
26476704 This study observed a significantly increased myelin basic protein (MBP) and nuclear distribution protein nudE-like 1 (NDEL1) mRNA levels in FEP patients compared with controls.
24785679 study provided comprehensive documentation of the expression patterns of Nde1 and Ndel1 in cultured cells as well as in mouse and human brains, and also highlighting that dosage effects of these two proteins might contribute to some cases of mental disorder
23388542 The Plasma Ndel1 enzyme activity is reduced in patients with schizophrenia.
22843697 analysis of mixed NDE1-NDEL1 complexes demonstrates that NDE1 and NDEL1 can interact directly.
22832604 Short (DISC)1 splice variants show reduced or no binding to nudE nuclear distribution E homolog (NDEL)1 and phosphodiesterase (PDE)4B proteins, but fully interact with FEZ1 and glycogen synthase kinase 3 (GSK3)beta.
22453242 Nudel markedly promotes the HSPC300-WAVE2 interaction.
22430153 Cytosolic mfGbeta is recruited to dynein by Nudel and transported to the centrosome for rapid sequestration and degradation.
22373868 Studies indicate that binding of dynactin, LIS1 and NudEL regulate cytoplasmic dynein motor activity.
21998303 DISC1 forms octamers via dimers as building blocks. S704C forms higher-order oligomers, without affecting its affinity with NDEL1
21948775 Nuclear distribution element-like 1 (Ndel1 or Nudel) was firstly described as a regulator of the cytoskeleton in microtubule and intermediate filament dynamics and microtubule-based transport.
More...

AA Sequence

MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ      1 - 70
RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE     71 - 140
QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV    141 - 210
QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ    211 - 280
ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV         281 - 345
//

Text Mined References (70)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26476704 2015 Increased expression of NDEL1 and MBP genes in the peripheral blood of antipsychotic-naïve patients with first-episode psychosis.
25416956 2014 A proteome-scale map of the human interactome network.
24785679 2014 The expression and roles of Nde1 and Ndel1 in the adult mammalian central nervous system.
23388542 2013 Plasma Ndel1 enzyme activity is reduced in patients with schizophrenia--a potential biomarker?
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843697 2012 The mitosis and neurodevelopment proteins NDE1 and NDEL1 form dimers, tetramers, and polymers with a folded back structure in solution.
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
22453242 2012 Nudel is crucial for the WAVE complex assembly in vivo by selectively promoting subcomplex stability and formation through direct interactions.
22430153 2012 Misfolded G? is recruited to cytoplasmic dynein by Nudel for efficient clearance.
More...