Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.23
PubTator Score 0.36

Knowledge Summary

Patent (245)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MATSNHSSGAEFILAGLTQRPELQLPLFLLFLGIYVVTVVGNLGMIFLIALSSQLYPPVYYFLSHLSFID      1 - 70
LCYSSVITPKMLVNFVPEENIISFLECITQLYFFLIFVIAEGYLLTAMEYDRYVAICRPLLYNIVMSHRV     71 - 140
CSIMMAVVYSLGFLWATVHTTRMSVLSFCRSHTVSHYFCDILPLLTLSCSSTHINEILLFIIGGVNTLAT    141 - 210
TLAVLISYAFIFSSILGIHSTEGQSKAFGTCSSHLLAVGIFFGSITFMYFKPPSSTTMEKEKVSSVFYIT    211 - 280
IIPMLNPLIYSLRNKDVKNALKKMTRGRQSS                                           281 - 311
//

Text Mined References (6)

PMID Year Title