Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.23
PubTator Score 0.36

Knowledge Summary

Patent (245)

Synonym

Accession Q9GZM6 B9EH49 Q6IFR0
Symbols JCG2

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

AA Sequence

MATSNHSSGAEFILAGLTQRPELQLPLFLLFLGIYVVTVVGNLGMIFLIALSSQLYPPVYYFLSHLSFID      1 - 70
LCYSSVITPKMLVNFVPEENIISFLECITQLYFFLIFVIAEGYLLTAMEYDRYVAICRPLLYNIVMSHRV     71 - 140
CSIMMAVVYSLGFLWATVHTTRMSVLSFCRSHTVSHYFCDILPLLTLSCSSTHINEILLFIIGGVNTLAT    141 - 210
TLAVLISYAFIFSSILGIHSTEGQSKAFGTCSSHLLAVGIFFGSITFMYFKPPSSTTMEKEKVSSVFYIT    211 - 280
IIPMLNPLIYSLRNKDVKNALKKMTRGRQSS                                           281 - 311
//

Text Mined References (6)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11705801 2001 New GPCRs from a human lingual cDNA library.