Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent (176)


  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.0077301331787387

AA Sequence

VVTPSLNPLIYTFRNKDVRGAVKRLMGWEWGM                                          281 - 312

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12730696 2003 Different noses for different people.