Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent (176)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 7.7e-03

AA Sequence

MLMKKNASFEDFFLLLGFSNWPHLEVVLFVVILIFYLITLIGNLFIIILSYLDSHLHTPMYFFLSNLSFL      1 - 70
DLCYTTSSIPQLLVNLWGPEKTISYAGCTVQLYFVLALGTAECVLLVVMSYDRYAAVCRPLHYTVLMHPR     71 - 140
FCRLLAAASWVSGFTTSALHSSFTFWIPLCRHRLVDHFFCEVPALLRLSCVDTQANELTLMVMSSIFVLI    141 - 210
PLILILTSYGAIARAVLSMQSTTGLQKVLRTCGAHLMVVSLFFIPVMCMYLQPPSENSQDQGKFIALFYT    211 - 280
VVTPSLNPLIYTFRNKDVRGAVKRLMGWEWGM                                          281 - 312
//

Text Mined References (3)

PMID Year Title