Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.68
PubTator Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q9C0J1 Q8N5W4 Q8N934 Q8ND21 Q8WWR5 Q8WY02 Q96QH5
Symbols B3GN-T4
beta3Gn-T4

Gene

PANTHER Protein Class (2)

AA Sequence

MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRKAAKPAGDPTAHQPFWAPPT      1 - 70
PRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIKSQPGHVERRAAIRST     71 - 140
WGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDDILQWDFTEDFFNLTLKELHLQRWVVAACPQ    141 - 210
AHFMLKGDDDVFVHVPNVLEFLDGWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGG    211 - 280
YVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHR    281 - 350
LSPLEMWTMWALVTDEGLKCAAGPIPQR                                              351 - 378
//

Text Mined References (9)

PMID Year Title
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042166 2001 Identification and characterization of three novel beta 1,3-N-acetylglucosaminyltransferases structurally related to the beta 1,3-galactosyltransferase family.
10580128 1999 Identification and characterization of large galactosyltransferase gene families: galactosyltransferases for all functions.