Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.95
PubTator Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.0e-11
malignant mesothelioma 3232 3.5e-08
psoriasis 6694 2.1e-04
group 3 medulloblastoma 4104 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.200 1.0e-03
malignant mesothelioma -2.100 3.5e-08
osteosarcoma 3.315 3.0e-11
psoriasis 1.800 2.1e-04

AA Sequence

MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRKAAKPAGDPTAHQPFWAPPT      1 - 70
PRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIKSQPGHVERRAAIRST     71 - 140
WGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDDILQWDFTEDFFNLTLKELHLQRWVVAACPQ    141 - 210
AHFMLKGDDDVFVHVPNVLEFLDGWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGG    211 - 280
YVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHR    281 - 350
LSPLEMWTMWALVTDEGLKCAAGPIPQR                                              351 - 378
//

Text Mined References (9)

PMID Year Title