Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.91
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
psoriasis 6694 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Heart disease 306 0.0 1.0
Disease Target Count Z-score Confidence
Entropion 22 4.43 2.2

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 2.2e-19
Breast cancer -1.800 5.0e-06
breast carcinoma -1.100 8.5e-23
COPD 1.300 2.8e-03
group 4 medulloblastoma -1.200 1.8e-02
invasive ductal carcinoma -2.400 6.7e-04
medulloblastoma, large-cell -1.700 2.0e-03
non-small cell lung cancer -1.177 3.2e-12
oligodendroglioma 1.100 2.7e-10
ovarian cancer -2.300 7.4e-06
pancreatic cancer 1.200 1.4e-02
pancreatic carcinoma 1.200 1.4e-02
tuberculosis -3.700 5.2e-09

Gene RIF (4)

AA Sequence

MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPWSTVENPSMDT      1 - 70
VNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQLCRSPCLEPHILKRNEILQDF     71 - 140
KPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEADQ    141 - 210
TVSTINTITRETSSLESQRSESPMQEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLER    211 - 280
GHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGII    281 - 350
VSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGK    351 - 420
KCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQ    421 - 490
SDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGQYP    491 - 560
SMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERRFSLDTDYRISSVASDCSSEG    561 - 630
SMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHK    631 - 700
PPLPHLALHLPHSAVGARSSCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSR    701 - 770
QEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREK    771 - 840
IYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY                               841 - 883
//

Text Mined References (10)

PMID Year Title