Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.91
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 1.200 0.014
astrocytoma 1.200 0.000
oligodendroglioma 1.100 0.000
medulloblastoma, large-cell -1.700 0.002
tuberculosis -3.700 0.000
non-small cell lung cancer -1.177 0.000
group 4 medulloblastoma -1.200 0.018
pancreatic carcinoma 1.200 0.014
COPD 1.300 0.003
breast carcinoma -1.100 0.000
Breast cancer -1.800 0.000
invasive ductal carcinoma -2.400 0.001
ovarian cancer -2.300 0.000

Gene RIF (4)

PMID Text
25391383 The Gene-based analyses revealed four significant associations in the WT1, ZC3H12C, DLGAP2, and GPR1 genes at p < 0.05. in this study.
23360436 Thus Zc3h12c is an endogenous inhibitor of TNFalpha-induced inflammatory signalling in HUVECs and might be a therapeutic target in vascular inflammatory diseases.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18178554 MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation.

AA Sequence

MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPWSTVENPSMDT      1 - 70
VNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQLCRSPCLEPHILKRNEILQDF     71 - 140
KPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQLVLNKLGTDALINDILGELVKLGNKSEADQ    141 - 210
TVSTINTITRETSSLESQRSESPMQEIVTDDGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLER    211 - 280
GHKDITVFVPAWRKEQSRPDALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGII    281 - 350
VSNDNYRDLANEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGK    351 - 420
KCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTSDVKRGAPKRQ    421 - 490
SDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSNGLPSGVHFPPQDQRPQGQYP    491 - 560
SMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLSLSGPRSPERRFSLDTDYRISSVASDCSSEG    561 - 630
SMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHK    631 - 700
PPLPHLALHLPHSAVGARSSCPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSR    701 - 770
QEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREK    771 - 840
IYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY                               841 - 883
//

Text Mined References (10)

PMID Year Title
25391383 2015 Genetic variation in imprinted genes is associated with risk of late-onset Alzheimer's disease.
23360436 2013 Zc3h12c inhibits vascular inflammation by repressing NF-?B activation and pro-inflammatory gene expression in endothelial cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18178554 2008 A novel CCCH-zinc finger protein family regulates proinflammatory activation of macrophages.
17903301 2007 Genome-wide association of echocardiographic dimensions, brachial artery endothelial function and treadmill exercise responses in the Framingham Heart Study.
17114934 The NYN domains: novel predicted RNAses with a PIN domain-like fold.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.