Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.59
PubTator Score 0.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.387 1.0e-03
atypical teratoid / rhabdoid tumor -2.600 2.1e-06
ependymoma -1.800 6.6e-05
glioblastoma -1.100 1.8e-02
group 4 medulloblastoma -1.500 4.3e-02
medulloblastoma, large-cell -1.900 1.4e-02
pediatric high grade glioma -1.100 3.1e-02
pituitary cancer 1.100 2.0e-02
psoriasis -1.700 1.0e-12

Gene RIF (1)

AA Sequence

MRWQCGTRFRGLRPAVAPWTALLALGLPGWVLAVSATAAAVVPEQHASVAGQHPLDWLLTDRGPFHRAQE      1 - 70
YADFMERYRQGFTTRYRIYREFARWKVNNLALERKDFFSLPLPLAPEFIRNIRLLGRRPNLQQVTENLIK     71 - 140
KYGTHFLLSATLGGEESLTIFVDKQKLGRKTETTGGASIIGGSGNSTAVSLETLHQLAASYFIDRESTLR    141 - 210
RLHHIQIATGAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKVQLLGLQVLLPEYLRERFVAAALSYI    211 - 280
TCSSEGELVCKENDCWCKCSPTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDD    281 - 350
RFLNSTAISQFWAMDTSLQHRYQQLGAGLKVLFKKTHRILRRLFNLCKRCHRQPRFRLPKERSLSYWWNR    351 - 420
IQSLLYCGESTFPGTFLEQSHSCTCPYDQSSCQGPIPCALGEGPACAHCAPDNSTRCGSCNPGYVLAQGL    421 - 490
CRPEVAESLENFLGLETDLQDLELKYLLQKQDSRIEVHSIFISNDMRLGSWFDPSWRKRMLLTLKSNKYK    491 - 560
PGLVHVMLALSLQICLTKNSTLEPVMAIYVNPFGGSHSESWFMPVNEGSFPDWERTNVDAAAQCQNWTIT    561 - 630
LGNRWKTFFETVHVYLRSRIKSLDDSSNETIYYEPLEMTDPSKNLGYMKINTLQVFGYSLPFDPDAIRDL    631 - 700
ILQLDYPYTQGSQDSALLQLIELRDRVNQLSPPGKVRLDLFSCLLRHRLKLANNEVGRIQSSLRAFNSKL    701 - 770
PNPVEYETGKLCS                                                             771 - 783
//

Text Mined References (8)

PMID Year Title