Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $146,666.67
PubMed Score 7.60
PubTator Score 13.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Synonym

Accession Q9C040 D3DP09 O60272 Q9BSI9 Q9UFZ1
Symbols CMT2R
RNF86

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (6)

PMID Text
26514622 Studies indicate most-studied TRIpartite Motif (TRIM)-NHL proteins TRIM2, TRIM3, TRIM32 and TRIM71, and their mutations have been linked to diseases.
25893792 TRIM2 homozygous missense mutation (c.2000A>C; p.D667A) in a patient with peripheral neuropathy and bilateral vocal cord paralysis
24817735 The functional role of the C-terminal NHL domain was characterized in TRIM2.
23898208 HIV-1 Tat downregulates the expression of tripartite motif containing 2 (TRIM2) in human primary T cells
21720722 TRIM2 is repressed by miR-9 and -181c, either alone or in combination.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILP      1 - 70
EKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRE     71 - 140
CTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDE    141 - 210
LQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEK    211 - 280
LNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITT    281 - 350
KDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK    351 - 420
VIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQ    421 - 490
GVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIF    491 - 560
SSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAV    561 - 630
NSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSG    631 - 700
SFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ                              701 - 744
//

Text Mined References (25)

PMID Year Title
26514622 2015 TRIM-NHL proteins in development and disease.
25893792 2015 Exome sequencing reveals homozygous TRIM2 mutation in a patient with early onset CMT and bilateral vocal cord paralysis.
25416956 2014 A proteome-scale map of the human interactome network.
25056437 2014 Differential expression of tripartite motif-containing family in normal human dermal fibroblasts in response to porcine endogenous retrovirus infection.
24817735 2014 Expression, purification, crystallization and preliminary X-ray diffraction analysis of the C-terminal NHL domain of human TRIM2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23799842 2013 Diagnostic SOX10 gene signatures in salivary adenoid cystic and breast basal-like carcinomas.
23562820 2013 Deficiency of the E3 ubiquitin ligase TRIM2 in early-onset axonal neuropathy.
21720722 2012 Target gene repression mediated by miRNAs miR-181c and miR-9 both of which are down-regulated by amyloid-?.
21654844 2011 Genome-wide association study of severity in multiple sclerosis.
More...