Property Summary

NCBI Gene PubMed Count 25
PubMed Score 8.19
PubTator Score 13.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.1
Disease Target Count
Charcot-Marie-Tooth disease type 2R 1

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.100 1.7e-05
Astrocytoma, Pilocytic -1.100 3.9e-03
atypical teratoid / rhabdoid tumor -2.900 5.1e-06
Breast cancer -2.800 8.4e-11
breast carcinoma -1.700 1.4e-05
cystic fibrosis 2.126 2.1e-07
glioblastoma -1.500 5.4e-04
group 3 medulloblastoma -1.500 5.7e-03
interstitial cystitis -1.500 2.5e-04
intraductal papillary-mucinous adenoma (... 2.900 1.1e-04
intraductal papillary-mucinous carcinoma... 2.600 2.6e-04
intraductal papillary-mucinous neoplasm ... 2.300 5.6e-03
invasive ductal carcinoma -1.029 6.7e-04
lung adenocarcinoma 1.100 1.4e-09
lung carcinoma 1.800 1.0e-15
malignant mesothelioma -3.500 5.3e-08
medulloblastoma, large-cell -2.900 4.7e-07
non-small cell lung cancer 1.587 1.3e-15
osteosarcoma 1.722 3.5e-03
ovarian cancer -1.300 1.3e-04
Pick disease -1.100 4.9e-03
progressive supranuclear palsy -1.300 2.9e-02
psoriasis -1.400 1.2e-06
spina bifida -2.080 4.0e-02
ulcerative colitis -1.287 4.6e-02

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILP      1 - 70
EKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRE     71 - 140
CTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDE    141 - 210
LQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEK    211 - 280
LNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITT    281 - 350
KDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK    351 - 420
VIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQ    421 - 490
GVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIF    491 - 560
SSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAV    561 - 630
NSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSG    631 - 700
SFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ                              701 - 744
//

Text Mined References (27)

PMID Year Title