Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.77
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.000 9.4e-04
astrocytic glioma 1.300 1.1e-02
Astrocytoma, Pilocytic -1.600 3.1e-04
atypical teratoid / rhabdoid tumor -2.900 1.1e-05
Breast cancer -1.100 1.1e-03
ependymoma -2.800 3.0e-09
facioscapulohumeral dystrophy -1.900 7.1e-05
glioblastoma -1.500 6.8e-04
group 3 medulloblastoma -2.300 3.5e-03
malignant mesothelioma 1.300 5.8e-06
medulloblastoma, large-cell -1.800 2.4e-05
oligodendroglioma 1.800 1.7e-03
Pick disease -1.100 3.4e-03
primitive neuroectodermal tumor -2.200 5.1e-04
progressive supranuclear palsy -1.100 2.0e-02

Gene RIF (5)

AA Sequence

MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSL      1 - 70
YSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDR     71 - 140
GLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLV    141 - 210
PPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQA    211 - 280
LNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR    281 - 350
DQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS    351 - 420
PLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREV    421 - 490
YVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTC    491 - 560
SSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHN    561 - 630
NSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVP    631 - 700
DFYSSRASIA                                                                701 - 710
//

Text Mined References (19)

PMID Year Title