Property Summary

NCBI Gene PubMed Count 30
Grant Count 2
R01 Count 2
Funding $345,825
PubMed Score 43.98
PubTator Score 30.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
active Crohn's disease -1.270 0.014

Synonym

Accession Q9BZW4 Q0IJ64
Symbols

Gene

 Grant Application (2)

Gene RIF (25)

PMID Text
26847197 This study investigates the association between TM6SF2 rs58542926 with health services utilization in a general population. TM6SF2 rs58542926 was associated with the number of outpatient visits, hospitalization, and inpatient days.
26745555 The TM6SF2 p.E167K variant is associated with non-alcoholic fatty liver disease.
26520056 In summary we found the TM6SF2 167K variant is associated with a higher prevalence of hepatic steatosis.
26493626 transmembrane 6 superfamily 2 C/T or T/T variants in conjunction with patatin-like phospho-lipase domain-containing protein 3 G/G variants may be potential genetic risk factors for developing HCC in alcohol-related cirrhosis.
26482880 Variants in the TM6SF2 gene is associated with alcohol-related cirrhosis.
26457389 The rs58542926 SNP in the TM6SF2 gene is associated with pediatric nonalcoholic fatty liver disease but may confer protection against cardiovascular risk
26331730 Although the TM6SF2-rs58542926 variant confers protection against cardiovascular disease at the expense of an increased risk of nonalcoholic fatty liver, it does not explain the link between these two complex diseases.
26331730 TM6SF2-rs58542926 has a dual and opposite role in protecting against cardiovascular disease and conferring risk for nonalcoholic fatty liver.
26272871 Treating liver fat and serum triglyceride levels in NAFLD, effects of PNPLA3 and TM6SF2 genotypes: effect of Omacor administration.
26259026 TM6SF2 rs58542926 is not associated with steatosis and fibrosis in large cohort of patients with genotype 1 Chronic hepatitis C.
More...

AA Sequence

MDIPPLAGKIAALSLSALPVSYALNHVSALSHPLWVALMSALILGLLFVAVYSLSHGEVSYDPLYAVFAV      1 - 70
FAFTSVVDLIIALQEDSYVVGFMEFYTKEGEPYLRTAHGVFICYWDGTVHYLLYLAMAGAICRRKRYRNF     71 - 140
GLYWLGSFAMSILVFLTGNILGKYSSEIRPAFFLTIPYLLVPCWAGMKVFSQPRALTRCTANMVQEEQRK    141 - 210
GLLQRPADLALVIYLILAGFFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPFC    211 - 280
GLAAYALTFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVPEDTWGCFFVCNLLYALGPHLL    281 - 350
AYRCLQWPAFFHQPPPSDPLALHKKQH                                               351 - 377
//

Text Mined References (32)

PMID Year Title
26847197 2016 Association of PNPLA3 rs738409 and TM6SF2 rs58542926 with health services utilization in a population-based study.
26745555 2016 Reduction of Caloric Intake Might Override the Prosteatotic Effects of the PNPLA3 p.I148M and TM6SF2 p.E167K Variants in Patients with Fatty Liver: Ultrasound-Based Prospective Study.
26520056 2016 Transmembrane-6 superfamily member 2 (TM6SF2) E167K variant increases susceptibility to hepatic steatosis in obese children.
26493626 2016 PNPLA3 rs738409 and TM6SF2 rs58542926 variants increase the risk of hepatocellular carcinoma in alcoholic cirrhosis.
26482880 2015 A genome-wide association study confirms PNPLA3 and identifies TM6SF2 and MBOAT7 as risk loci for alcohol-related cirrhosis.
26457389 2016 Role of TM6SF2 rs58542926 in the pathogenesis of nonalcoholic pediatric fatty liver disease: A multiethnic study.
26331730 2015 The dual and opposite role of the TM6SF2-rs58542926 variant in protecting against cardiovascular disease and conferring risk for nonalcoholic fatty liver: A meta-analysis.
26272871 2015 Treating liver fat and serum triglyceride levels in NAFLD, effects of PNPLA3 and TM6SF2 genotypes: Results from the WELCOME trial.
26259026 2016 TM6SF2 rs58542926 is not associated with steatosis and fibrosis in large cohort of patients with genotype 1 chronic hepatitis C.
25893821 2016 TM6SF2 Glu167Lys polymorphism is associated with low levels of LDL-cholesterol and increased liver injury in obese children.
More...