Property Summary

NCBI Gene PubMed Count 42
PubMed Score 58.10
PubTator Score 30.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
active Crohn's disease 922 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Fatty liver disease 103 5.794 2.9
Disease Target Count Z-score Confidence
Liver disease 237 3.782 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
active Crohn's disease -1.270 1.4e-02

Gene RIF (37)

AA Sequence

MDIPPLAGKIAALSLSALPVSYALNHVSALSHPLWVALMSALILGLLFVAVYSLSHGEVSYDPLYAVFAV      1 - 70
FAFTSVVDLIIALQEDSYVVGFMEFYTKEGEPYLRTAHGVFICYWDGTVHYLLYLAMAGAICRRKRYRNF     71 - 140
GLYWLGSFAMSILVFLTGNILGKYSSEIRPAFFLTIPYLLVPCWAGMKVFSQPRALTRCTANMVQEEQRK    141 - 210
GLLQRPADLALVIYLILAGFFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPFC    211 - 280
GLAAYALTFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVPEDTWGCFFVCNLLYALGPHLL    281 - 350
AYRCLQWPAFFHQPPPSDPLALHKKQH                                               351 - 377
//

Text Mined References (44)

PMID Year Title