Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.69
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 0.003

Synonym

Accession Q9BZV1 D6W626 Q96AH1 Q96IK9 Q9BZV0
Symbols UBXD1
UBXDC2

Gene

Gene RIF (7)

PMID Text
26475856 UBXD1-N intercalates into the p97-ND1 interface, thereby modulating interdomain communication of p97 domains and its activity with relevance for disease pathogenesis
23335559 Data indicate that endosomal trafficking of CAV1 depends on ubiquitination of the N-terminal region and the subsequent recruitment of VCP-UBXD1.
22337587 UBXD1 modulates the trafficking of ERGIC-53-containing vesicles by controlling the interaction of transport factors with the cytoplasmic tail of ERGIC-53.
21822278 Data show that expression of VCP mutant proteins, or siRNA-mediated depletion of UBXD1 leads to a block of CAV1 transport at the limiting membrane of enlarged endosomes in cultured cells.
19275885 these findings suggest that UBXD1 is a regulatory component of endoplasmic reticulum-associated degradation that may modulate the adaptor binding to VCP.
19174149 An additional p97 binding site in UBXD1 that competed with the p47 cofactor for binding to the N domain of p97 was identified.
18656546 UBXD1 is a novel co-factor of the human p97 ATPase.

AA Sequence

MKKFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQKQSRA      1 - 70
WGPTSQDTIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPGVYFTCPLTGATLRKDQRDAC     71 - 140
IKEAILLHFSTDPVAASIMKIYTFNKDQDRVKLGVDTIAKYLDNIHLHPEEEKYRKIKLQNKVFQERINC    141 - 210
LEGTHEFFEAIGFQKVLLPAQDQEDPEEFYVLSETTLAQPQSLERHKEQLLAAEPVRAKLDRQRRVFQPS    211 - 280
PLASQFELPGDFFNLTAEEIKREQRLRSEAVERLSVLRTKAMREKEEQRGLRKYNYTLLRVRLPDGCLLQ    281 - 350
GTFYARERLGAVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKA    351 - 420
AGAEPDSILKPELLSAIEKLL                                                     421 - 441
//

Text Mined References (21)

PMID Year Title
26475856 2015 The N-terminal Region of the Ubiquitin Regulatory X (UBX) Domain-containing Protein 1 (UBXD1) Modulates Interdomain Communication within the Valosin-containing Protein p97.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23335559 2013 Ubiquitination of the N-terminal region of caveolin-1 regulates endosomal sorting by the VCP/p97 AAA-ATPase.
22337587 2012 Protein interaction profiling of the p97 adaptor UBXD1 points to a role for the complex in modulating ERGIC-53 trafficking.
21896481 2011 The general definition of the p97/valosin-containing protein (VCP)-interacting motif (VIM) delineates a new family of p97 cofactors.
21822278 2011 Endolysosomal sorting of ubiquitylated caveolin-1 is regulated by VCP and UBXD1 and impaired by VCP disease mutations.
21269460 2011 Initial characterization of the human central proteome.
19275885 2009 UBXD1 is a VCP-interacting protein that is involved in ER-associated degradation.
More...