Property Summary

NCBI Gene PubMed Count 804
PubMed Score 6233.75
PubTator Score 2498.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 2.0e-75
ovarian cancer 8520 1.8e-06
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.698 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.000 2.0e-75
ovarian cancer -1.200 1.8e-06

Protein-protein Interaction (5)

Gene RIF (801)

AA Sequence

MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ      1 - 70
LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV     71 - 140
FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE    141 - 210
PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSC    211 - 280
CIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAI    281 - 350
LEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR    351 - 420
PSRCSNPTPGP                                                               421 - 431
//

Text Mined References (811)

PMID Year Title