Property Summary

NCBI Gene PubMed Count 33
Grant Count 72
R01 Count 32
Funding $18,589,620.74
PubMed Score 419.68
PubTator Score 197.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer -1.717 0.000
lung cancer -2.100 0.000
lung carcinoma -1.100 0.000
gastric carcinoma -5.400 0.020

Synonym

Accession Q9BZP6 Q32W79 Q32W80 Q3B866 Q5U5Z5 Q5VUV4 Q86UD8 Q9ULY3 Q9ULY4 AMCase
Symbols CHIT2
AMCASE
TSA1902

Gene

PANTHER Protein Class (2)

PDB

2YBT   2YBU   3FXY   3FY1   3RM4   3RM8   3RM9   3RME  

Gene RIF (29)

PMID Text
24903994 These data provide the experimental evidence that telomere shortening and related inflammatory proteins are associated with human IgAN, and it could be a new direction for the disease progression study.
24119614 loss of acidic chitinase expression is a promising marker for corpus atrophy
23129258 results showed that the expression of AMCase and CHIT-1 were differently modulated in monocyte macrophages at different stage of maturation. The behavior of these two active chitinase suggests that in the immune response their role is complementary.
22200767 study demonstrated genetic associations between chitinase gene variants and lung function level and rate of decline in chronic obstructive pulmonary disease patients from the Lung Health Study; also functional effect of the rs3818822 polymorphism on AMCase levels and activity was demonstrated
21711963 increased chitinolytic activity in nasal polyps
21511453 A ten base pair insertion in the second exon in the 5'UTR region of the AMCase gene may modify the gene expression and thus may affect the severity of asthma.
21303604 AMCase and eotaxin-3 may be important mediators in the pathogenesis of nasal polyps. The increased AMCase and eotaxin-3 might lead to nasal polyp formation and growth.
21159721 Report increased CSF chitinase levels in patients with neuromyelitis optica and relapsing remitting multiple sclerosis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20538957 Environmental exposure to fungi does not modify the effect of CHIA SNPs on severe asthma exacerbations
More...

AA Sequence

MTKLILLTGLVLILNLQLGSAYQLTCYFTNWAQYRPGLGRFMPDNIDPCLCTHLIYAFAGRQNNEITTIE      1 - 70
WNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWE     71 - 140
YPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVM    141 - 210
TYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTG    211 - 280
IGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLK    281 - 350
HNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSS    351 - 420
GGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA                  421 - 476
//

Text Mined References (35)

PMID Year Title
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
24903994 2014 Proteins induced by telomere dysfunction are associated with human IgA nephropathy.
24119614 2013 Transcriptome signatures in Helicobacter pylori-infected mucosa identifies acidic mammalian chitinase loss as a corpus atrophy marker.
23129258 2013 Evaluation of AMCase and CHIT-1 expression in monocyte macrophages lineage.
22200767 2012 Genetic association between human chitinases and lung function in COPD.
21711963 Chitinolytic activity in nasal polyps.
21511453 2011 The effects of an insertion in the 5'UTR of the AMCase on gene expression and pulmonary functions.
21303604 2011 Expression and role of acidic mammalian chitinase and eotaxin-3 in chronic rhinosinusitis with nasal polyps.
21159721 2011 Chitinase effects on immune cell response in neuromyelitis optica and multiple sclerosis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
More...