Property Summary

NCBI Gene PubMed Count 36
PubMed Score 52.06
PubTator Score 36.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.2e-18
Disease Target Count Z-score Confidence
Cancer 2499 3.503 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.2e-18

Gene RIF (30)

AA Sequence

MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHK      1 - 70
AKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQ     71 - 140
FLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKP    141 - 210
PSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR                                        211 - 244
//

Text Mined References (38)

PMID Year Title