Property Summary

NCBI Gene PubMed Count 10
Grant Count 49
R01 Count 33
Funding $4,081,338.37
PubMed Score 36.00
PubTator Score 25.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 0.000

Gene RIF (5)

PMID Text
25816740 4q12 translocations with GSX2 expression identify a CD7(+) acute myeloid leukaemia subset.
22242181 Gsx2 negatively regulates neurogenesis from postnatal progenitor cells.
21368052 Transgenic mice lacking microRNAs miR-9-2 and miR-9-3 exhibit multiple defects of telencephalic structures which may be brought about by dysregulation of Foxg1, Nr2e1, Gsh2, and Meis2 expression.
19709628 Gsx2 specifies striatal projection neuron and olfactory bulb interneuron identity at distinct time points during neurogenesis in transgenic mice.
11861295 ectopically expressed in myeloid leukemic cells with t(4;12)(q11-q12;p13), suggesting that expression of GSH2 was deregulated by the translocation, indicating a variant leukemogenic mechanism for translocations involving the 5' end of ETV6

AA Sequence

MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH      1 - 70
SSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKGQFSSAPGDAQFCPRVNHAHHHHHPPQHHHHHHQ     71 - 140
PQQPGSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYNVADPRRFHCLTMGGSDASQVPNGKRMRTAFT    141 - 210
STQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVH    211 - 280
YARSEDEDSLSPASANDDKEISPL                                                  281 - 304
//

Text Mined References (11)

PMID Year Title
25816740 2015 4q12 translocations with GSX2 expression identify a CD7(+) acute myeloid leukaemia subset.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
22242181 2012 The homeobox gene Gsx2 regulates the self-renewal and differentiation of neural stem cells and the cell fate of postnatal progenitors.
21368052 2011 MicroRNA-9 regulates neurogenesis in mouse telencephalon by targeting multiple transcription factors.
19709628 2009 Distinct temporal requirements for the homeobox gene Gsx2 in specifying striatal and olfactory bulb neuronal fates.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12205114 2002 Heterozygous truncating mutation in the human homeobox gene GSH2 has no discernable phenotypic effect.
More...