Property Summary

NCBI Gene PubMed Count 10
PubMed Score 38.81
PubTator Score 25.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.8e-21
Disease Target Count Z-score Confidence
Huntington's disease 76 3.507 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 3.8e-21

Gene RIF (5)

AA Sequence

MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH      1 - 70
SSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKGQFSSAPGDAQFCPRVNHAHHHHHPPQHHHHHHQ     71 - 140
PQQPGSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYNVADPRRFHCLTMGGSDASQVPNGKRMRTAFT    141 - 210
STQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGTQRNSHAGCKCVGSQVH    211 - 280
YARSEDEDSLSPASANDDKEISPL                                                  281 - 304
//

Text Mined References (11)

PMID Year Title