Property Summary

NCBI Gene PubMed Count 10
PubMed Score 15.54
PubTator Score 16.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.500 1.3e-06
atypical teratoid / rhabdoid tumor -1.400 3.8e-07
ependymoma -1.100 4.8e-09
glioblastoma -1.400 9.3e-06
group 4 medulloblastoma -1.200 9.4e-05
medulloblastoma, large-cell -1.700 3.2e-06

Gene RIF (3)

AA Sequence

MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACAGGDLDEARLM      1 - 70
LRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFLVEQGATVNQADNEGWTPLHV     71 - 140
AASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTR    141 - 210
CWLNGGAMPEARHPRTGASALHVAAAKGYIEVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLA    211 - 280
EHGGGMDSLTHAGQRPCDLADEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSS    281 - 350
REKISLQDLSKERRPGGAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPVQLEEAPFSRRF    351 - 420
GLLKTGSSGALGPPERRTAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSPKLPEPSVLSEVTK    421 - 490
PPPCLENSSPPSRIPEPESPAKPNVPTASTAPPADSRDRRRSYQMPVRDEESESQRKARSRLMRQSRRST    491 - 560
QGVTLTDLKEAEKAAGKAPESEKPAQSLDPSRRPRVPGVENSDSPAQRAEAPDGQGPGPQAAREHRKVGK    561 - 630
EWRGPAEGEEAEPADRSQESSTLEGGPSARRQRWQRDLNPEPEPESEEPDGGFRTLYAELRRENERLREA    631 - 700
LTETTLRLAQLKVELERATQRQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDEN    701 - 770
AALIRVISKLSK                                                              771 - 782
//

Text Mined References (22)

PMID Year Title