Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZK8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPVAPSNHCDNQCPHIFSKALVVSVAPSPPRDKPAPYTFTDVSSLCGLQKKCEGGKAMLFTLKRDRFSFL      1 - 70
LFVSHC                                                                     71 - 76
//