Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.41
PubTator Score 0.54

Knowledge Summary

Patent (1,369)

AA Sequence

MANSTGLNASEVAGSLGLILAAVVEVGALLGNGALLVVVLRTPGLRDALYLAHLCVVDLLAAASIMPLGL      1 - 70
LAAPPPGLGRVRLGPAPCRAARFLSAALLPACTLGVAALGLARYRLIVHPLRPGSRPPPVLVLTAVWAAA     71 - 140
GLLGALSLLGTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPA    141 - 210
RGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQFAACWLPYGCACLAPAARAAEAEAAVTWVAY    211 - 280
SAFAAHPFLYGLLQRPVRLALGRLSRRALPGPVRACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPE    281 - 350
LAGGRSPAYQGPPESSLS                                                        351 - 368
//

Text Mined References (5)

PMID Year Title
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11165367 2001 Identification of four novel human G protein-coupled receptors expressed in the brain.