Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.58
PubTator Score 0.54

Knowledge Summary

Patent (1,369)

Expression

AA Sequence

MANSTGLNASEVAGSLGLILAAVVEVGALLGNGALLVVVLRTPGLRDALYLAHLCVVDLLAAASIMPLGL      1 - 70
LAAPPPGLGRVRLGPAPCRAARFLSAALLPACTLGVAALGLARYRLIVHPLRPGSRPPPVLVLTAVWAAA     71 - 140
GLLGALSLLGTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPA    141 - 210
RGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQFAACWLPYGCACLAPAARAAEAEAAVTWVAY    211 - 280
SAFAAHPFLYGLLQRPVRLALGRLSRRALPGPVRACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPE    281 - 350
LAGGRSPAYQGPPESSLS                                                        351 - 368
//

Text Mined References (5)

PMID Year Title