Property Summary

NCBI Gene PubMed Count 16
PubMed Score 30.56
PubTator Score 24.42

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MRRQVMAALVVSGAAEQGGRDGPGRGRAPRGRVANQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQ      1 - 70
QAQAKKVALQMPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGADFLVHYGHSCLIP     71 - 140
MDTSAQDFRVLYVFVDIRIDTTHLLDSLRLTFPPATALALVSTIQFVSTLQAAAQELKAEYRVSVPQCKP    141 - 210
LSPGEILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEA    211 - 280
IATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVDVWVQVACPRL    281 - 350
SIDWGTAFPKPLLTPYEAAVALRDISWQQPYPMDFYAGSSLGPWTVNHGQDRRPHAPGRPARGKVQEGSA    351 - 420
RPPSAVACEDCSCRDEKVAPLAP                                                   421 - 443
//

Text Mined References (19)

PMID Year Title