Property Summary

NCBI Gene PubMed Count 2
Grant Count 3
R01 Count 1
Funding $409,069
PubMed Score 34.52
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 0.022
gastric carcinoma -1.800 0.013
psoriasis -1.900 0.000

AA Sequence

MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQL      1 - 70
TTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIP     71 - 140
VHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLD    141 - 210
TLMCQQAHGLPLPAWASPDVLRTLAQISALDIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPL    211 - 280
KMVMYSAHDSTLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSL    281 - 350
PGCPAPCPLGRFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR    351 - 420
ALGGPV                                                                    421 - 426
//

Text Mined References (2)

PMID Year Title
15219672 2004 Regulation of ErbB4 phosphorylation and cleavage by a novel histidine acid phosphatase.
11414767 2001 Molecular cloning of a novel human acid phosphatase gene (ACPT) that is highly expressed in the testis.