Property Summary

NCBI Gene PubMed Count 4
PubMed Score 37.36
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
AMELOGENESIS IMPERFECTA, TYPE IJ 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.0e-19
gastric carcinoma 807 1.3e-02
non primary Sjogren syndrome sicca 891 2.2e-02
Disease Target Count Z-score Confidence
Amelogenesis imperfecta 29 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma -1.800 1.3e-02
non primary Sjogren syndrome sicca 1.400 2.2e-02
psoriasis -1.900 4.0e-19

Gene RIF (2)

AA Sequence

MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQL      1 - 70
TTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIP     71 - 140
VHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLD    141 - 210
TLMCQQAHGLPLPAWASPDVLRTLAQISALDIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPL    211 - 280
KMVMYSAHDSTLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSL    281 - 350
PGCPAPCPLGRFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR    351 - 420
ALGGPV                                                                    421 - 426
//

Text Mined References (4)

PMID Year Title