Property Summary

NCBI Gene PubMed Count 16
Grant Count 244
R01 Count 156
Funding $20,765,027.04
PubMed Score 1443.28
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.117 0.006
psoriasis 1.600 0.000
osteosarcoma -1.232 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.500 0.000
juvenile dermatomyositis 1.096 0.000
Amyotrophic Lateral Sclerosis 1.062 0.000
acute quadriplegic myopathy 1.611 0.000
lung cancer 2.500 0.001
colon cancer 1.300 0.002
ovarian cancer 2.700 0.000
dermatomyositis 1.200 0.001

Synonym

Accession Q9BZE4 B3KMC5 B4DY13 B7Z7A3 O95446 Q5T3R8 Q9NVJ8
Symbols NGB
CRFG
NOG1

Gene

Gene RIF (3)

PMID Text
19460752 Knockdown of GTP binding protein 4 (GTPBP4) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17210637 NGB is a tumor suppressor that regulates and requires merlin to suppress cell proliferation
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFP      1 - 70
KLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTV     71 - 140
IKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHM    141 - 210
DYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFI    211 - 280
NKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKG    281 - 350
NKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLM    351 - 420
NLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREK    421 - 490
KKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAP    491 - 560
PSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGK    561 - 630
KDRR                                                                      631 - 634
//

Text Mined References (25)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...