Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1313.36
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.611 2.8e-06
Amyotrophic lateral sclerosis 1.062 2.4e-06
atypical teratoid / rhabdoid tumor 1.200 7.9e-07
colon cancer 1.200 3.6e-03
dermatomyositis 1.200 8.6e-04
juvenile dermatomyositis 1.096 1.4e-07
lung cancer 1.400 6.1e-04
medulloblastoma, large-cell 1.500 1.0e-04
Multiple myeloma 1.030 5.0e-03
osteosarcoma -1.232 1.0e-04
ovarian cancer 2.700 6.5e-06
psoriasis 1.300 4.4e-04

Gene RIF (4)

AA Sequence

MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFP      1 - 70
KLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTV     71 - 140
IKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHM    141 - 210
DYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFI    211 - 280
NKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKG    281 - 350
NKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLM    351 - 420
NLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREK    421 - 490
KKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAP    491 - 560
PSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGK    561 - 630
KDRR                                                                      631 - 634
//

Text Mined References (27)

PMID Year Title