Property Summary

NCBI Gene PubMed Count 3
PubMed Score 17.11
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZD3
Symbols GLURR2
GRINL1B

Gene

 GO Process (1)

Gene RIF (1)

AA Sequence

MCLLPRGFEPQAPEDLAQRSLVELREMLKLQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR      1 - 70
KNELFHPVSLDCKLRQKAIAEVDVGTDKARNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD     71 - 140
EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPQHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE    141 - 210
ENASTKNLTGLSSGTQKKPHYMEVLEMRAKNPGPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSKERRRR    211 - 280
DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERPNIKMRSYNPEGESS    281 - 350
GRYREVRDEDDDWSSDEF                                                        351 - 368
//

Text Mined References (3)

PMID Year Title