Property Summary

NCBI Gene PubMed Count 3
PubMed Score 15.01
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BZD3
Symbols GLURR2
GRINL1B

Gene

Gene RIF (1)

PMID Text
12063407 Assignment of GRINL1B, a glutamate receptor-like processed gene, to human chromosome 4q12

AA Sequence

MCLLPRGFEPQAPEDLAQRSLVELREMLKLQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR      1 - 70
KNELFHPVSLDCKLRQKAIAEVDVGTDKARNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD     71 - 140
EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPQHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE    141 - 210
ENASTKNLTGLSSGTQKKPHYMEVLEMRAKNPGPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSKERRRR    211 - 280
DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERPNIKMRSYNPEGESS    281 - 350
GRYREVRDEDDDWSSDEF                                                        351 - 368
//

Text Mined References (3)

PMID Year Title
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12063407 2001 Assignment of GRINL1B, a glutamate receptor-like processed gene, to human chromosome 4q12 by in situ hybridization.