Property Summary

NCBI Gene PubMed Count 34
Grant Count 137
R01 Count 83
Funding $24,541,453.5
PubMed Score 171.08
PubTator Score 74.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BZB8 B7Z6C6 Q86W46 Q8IV41 Q9BZB7 Q9H8V5 CPE-BP1
Symbols CPEB
CPEB-1
h-CPEB
CPE-BP1
hCPEB-1

Gene

PDB

2N1O   2M13   2MKE   2MKH   2MKK  

Gene RIF (21)

PMID Text
26627607 Identify a mechanism of VEGF overexpression in liver and mesentery that promotes pathologic, but not physiologic, angiogenesis, via sequential and nonredundant functions of CPEB1 and CPEB4.
26456073 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation has been described.
26398195 CPEB1, 2, and 4, are essential to successful mitotic cell division.
25216517 Results suggest that CPEB1-mediated translational control is essential for the differentiation of GSCs.
24141422 FMRP and CPEB1, an activator of translation, are present in neuronal dendrites, are predicted to bind many of the same mRNAs and may mediate a translational homeostasis that, when imbalanced, results in fragile X syndrome.
23788032 Downregulation of CPEB1 induces senescence of glioma cells in a p53-dependent manner.
23500490 The structural similarity to other ZZ domains suggests that the CPEB1-ZZ domain recruits sumoylated proteins during assembly of the ribonucleoprotein complex prior to mRNA export from the nucleus.
23434754 results reveal a novel function of CPEB1 in mediating alternative 3'-UTR processing, which is coordinated with regulation of mRNA translation, through its dual nuclear and cytoplasmic functions
23178487 CPEB accelerates deadenylation and decay of the c-myc mRNA by recruiting the Tob-Caf1 complex.
22727665 poly(A) polymerase Gld2, deadenylase PARN, and translation inhibitory factor neuroguidin (Ngd) are components of a dendritic CPEB-associated polyadenylation apparatus
More...

AA Sequence

MALSLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEE      1 - 70
TVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLG     71 - 140
KPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPP    141 - 210
LPFLSLSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREAR    211 - 280
LHRQAAAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPR    281 - 350
CPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVR    351 - 420
SPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSA    421 - 490
AFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQ    491 - 560
KNRDSS                                                                    561 - 566
//

Text Mined References (37)

PMID Year Title
26627607 2016 Sequential Functions of CPEB1 and CPEB4 Regulate Pathologic Expression of Vascular Endothelial Growth Factor and Angiogenesis in Chronic Liver Disease.
26456073 2015 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation.
26398195 2015 Global Analysis of CPEBs Reveals Sequential and Non-Redundant Functions in Mitotic Cell Cycle.
26063658 2015 Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease.
25216517 2014 CPEB1 modulates differentiation of glioma stem cells via downregulation of HES1 and SIRT1 expression.
24141422 2013 Genetic and acute CPEB1 depletion ameliorate fragile X pathophysiology.
23892092 2013 Exploration of deleterious single nucleotide polymorphisms in the components of human P bodies: an in silico approach.
23788032 2013 CPEB1, a histone-modified hypomethylated gene, is regulated by miR-101 and involved in cell senescence in glioma.
23776146 Specificity factors in cytoplasmic polyadenylation.
23500490 2013 The C-terminal region of cytoplasmic polyadenylation element binding protein is a ZZ domain with potential for protein-protein interactions.
More...