Property Summary

NCBI Gene PubMed Count 40
PubMed Score 178.76
PubTator Score 74.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.700 2.7e-05
astrocytic glioma -1.600 3.9e-03
Astrocytoma, Pilocytic -1.200 2.9e-06
atypical teratoid / rhabdoid tumor -2.600 2.2e-12
cystic fibrosis 1.174 3.6e-04
ductal carcinoma in situ -1.100 3.0e-03
ependymoma -2.000 4.4e-03
glioblastoma -1.400 2.2e-05
group 3 medulloblastoma -1.800 3.3e-04
intraductal papillary-mucinous adenoma (... -1.300 1.4e-03
intraductal papillary-mucinous carcinoma... -1.400 5.2e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.4e-03
invasive ductal carcinoma -1.500 9.9e-03
malignant mesothelioma 1.500 6.0e-06
medulloblastoma, large-cell -2.000 1.0e-05
oligodendroglioma -1.200 4.0e-02
osteosarcoma 1.947 5.3e-03
primitive neuroectodermal tumor -1.600 2.7e-02

Protein-protein Interaction (8)

Gene RIF (27)

AA Sequence

MALSLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEE      1 - 70
TVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLG     71 - 140
KPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPP    141 - 210
LPFLSLSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREAR    211 - 280
LHRQAAAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPR    281 - 350
CPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVR    351 - 420
SPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSA    421 - 490
AFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQ    491 - 560
KNRDSS                                                                    561 - 566
//

Text Mined References (44)

PMID Year Title