Property Summary

NCBI Gene PubMed Count 129
Grant Count 9
Funding $2,482,510.5
PubMed Score 151.31
PubTator Score 198.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.300 0.031
ependymoma 1.400 0.032
oligodendroglioma 1.400 0.018
osteosarcoma 1.117 0.000
cystic fibrosis -1.651 0.001
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
Atopic dermatitis -1.200 0.002
pancreatic ductal adenocarcinoma liver m... 1.845 0.000
breast carcinoma -1.200 0.000
Breast cancer -3.900 0.022
group 4 medulloblastoma -1.200 0.001
invasive ductal carcinoma -1.752 0.002
ductal carcinoma in situ -1.400 0.000

Gene RIF (143)

PMID Text
26666372 findings suggest that genetic variants of ADAM33 gene may play important roles in asthma susceptibility in the Punjabi population of Pakistan
26553447 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma
26291893 We investigated the influence of ADAM33 polymorphisms on the serum levels of ADAM33 and the susceptibility to pediatric asthma in the Chinese Han population
25840998 the intima+media of IPAH vessels, collagens (COL4A5, COL14A1, and COL18A1), matrix metalloproteinase (MMP) 19, and a disintegrin and metalloprotease (ADAM) 33 were higher expressed, whereas MMP10, ADAM17, TIMP1, and TIMP3 were less abundant.
25768087 a compromised ADAM33 gene may be implicated in the progression of wheeze into childhood asthma
25739290 Apparently, the investigated polymorphisms of VDBP, MMP1, ADAM33, and IL8 contribute to the genetic susceptibility to chronic bronchitis induced by dust and toxic agents.
25730038 Our results suggest that the ADAM33 V4 polymorphism increases the risk of asthma.
25453333 The results of this study suggest that these proteins play important roles in pulmonary inflammatory reactions elicited against etiological viral agents.
25369941 ADAM33 was involved in the pathogenesis of chronic obstructive pulmonary disease in an East Asian population by affecting airway inflammation and immune response.
25313536 Association between ADAM33 polymorphisms and susceptibility with adult and childhood asthma among Jordanians.
More...

AA Sequence

MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVAL      1 - 70
EAEGQELLLELEKNHRLLAPGYIETHYGPDGQPVVLAPNHTDHCHYQGRVRGFPDSWVVLCTCSGMSGLI     71 - 140
TLSRNASYYLRPWPPRGSKDFSTHEIFRMEQLLTWKGTCGHRDPGNKAGMTSLPGGPQSRGRREARRTRK    141 - 210
YLELYIVADHTLFLTRHRNLNHTKQRLLEVANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLW    211 - 280
AFLQWRRGLWAQRPHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHS    281 - 350
LGLSHDPDGCCVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPPALC    351 - 420
GNGFVEAGEECDCGPGQECRDLCCFAHNCSLRPGAQCAHGDCCVRCLLKPAGALCRQAMGDCDLPEFCTG    421 - 490
TSSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSE    491 - 560
GHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQ    561 - 630
CGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHD    631 - 700
TFLLAMLLSVLLPLLPGAGLAWCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHRDHPLGGVHPMELGPTA    701 - 770
TGQPWPLDPENSHEPSSHPEKPLPAVSPDPQADQVQMPRSCLW                               771 - 813
//

Text Mined References (130)

PMID Year Title
26666372 2016 Genetic variants of ADAM33 are associated with asthma susceptibility in the Punjabi population of Pakistan.
26553447 2016 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma.
26291893 2015 The ADAM33 S2 polymorphism is associated with susceptibility to pediatric asthma in the Chinese Han population.
25840998 2015 Compartment-specific expression of collagens and their processing enzymes in intrapulmonary arteries of IPAH patients.
25768087 2015 An ADAM33 polymorphism associates with progression of preschool wheeze into childhood asthma: a prospective case-control study with replication in a birth cohort study.
25739290 2014 [Analysis of polymorphisms of genes associated with immune response and tissue remodeling in occupational chronic bronchitis].
25730038 2015 Association between V4 polymorphism in the ADAM33 gene and asthma risk: a meta-analysis.
25453333 2014 The roles of ADAM33, ADAM28, IL-13 and IL-4 in the development of lung injuries in children with lethal non-pandemic acute infectious pneumonia.
25416956 2014 A proteome-scale map of the human interactome network.
25369941 2014 Genetic variants in ADAM33 are associated with airway inflammation and lung function in COPD.
More...