Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 7
Funding $1,347,096.5
PubMed Score 41.46
PubTator Score 10.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26307071 Role of beta-Carotene 9,10-Dioxygenase in Macular Pigment Metabolism
24982131 Inactivity of human beta,beta-carotene-9',10'-dioxygenase (BCO2) underlies retinal accumulation of the human macular carotenoid pigment.
24106281 a stepwise cleavage by BCO2 and BCO1 with APO10ol as an intermediate could provide a mechanism to tailor asymmetric carotenoids such as beta-cryptoxanthin for vitamin A production.
21302131 The gene encoding beta-carotene-9',10'-oxygenase, which cleaves the 9',10' double bond in beta-carotene into beta-apo-10'-carotenal, was cloned and expressed in Escherichia coli.
21106934 we found that the third family member, beta,beta-carotene-9',10'-oxygenase (BCDO2), is a mitochondrial carotenoid-oxygenase with broad substrate specificity
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFFRVFLHFIRSHSATAVDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTTVEEAPRGISA      1 - 70
RVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRI     71 - 140
VISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKTE    141 - 210
KVDWSKFIAVNGATAHPHYDLDGTAYNMGNSFGPYGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKG    211 - 280
KPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYS    281 - 350
KPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLN    351 - 420
APEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLV    421 - 490
GDSLIKVDVVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITPNQNESNFILVLDAKNFEELG    491 - 560
RAEVPVQMPYGFHGTFIPI                                                       561 - 579
//

Text Mined References (21)

PMID Year Title
26307071 2015 Characterization of the Role of ?-Carotene 9,10-Dioxygenase in Macular Pigment Metabolism.
24982131 2014 Inactivity of human ?,?-carotene-9',10'-dioxygenase (BCO2) underlies retinal accumulation of the human macular carotenoid pigment.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
24106281 2013 Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21302131 2011 Production of ?-apo-10'-carotenal from ?-carotene by human ?-carotene-9',10'-oxygenase expressed in E. coli.
21106934 2011 A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20150558 2010 Genome-wide association study identifies variants at the IL18-BCO2 locus associated with interleukin-18 levels.
More...