Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Atopic dermatitis 952 6.8e-03

AA Sequence

MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCGQPTPCSTTCRTSSC                      71 - 123
//

Text Mined References (3)

PMID Year Title