Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Atopic dermatitis 944

Synonym

Accession Q9BYT5 A8MTN3 A8MXM4
Symbols KAP2.2

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCGQPTPCSTTCRTSSC                      71 - 123
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.
11181995 2001 The sequence of the human genome.