Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Atopic dermatitis 944 0.00676528373964648

Synonym

Accession Q9BYT5 A8MTN3 A8MXM4
Symbols KAP2.2

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCGQPTPCSTTCRTSSC                      71 - 123
//

Text Mined References (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.
11181995 2001 The sequence of the human genome.