Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.38
PubTator Score 0.55

Knowledge Summary

Patent

No data available

AA Sequence

MTGSCCGSTLSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ      1 - 70
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC                 71 - 128
//

Text Mined References (5)

PMID Year Title