Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.300 2.5e-04
Atopic dermatitis -1.500 7.7e-03
medulloblastoma, large-cell 1.400 5.6e-05
osteosarcoma 1.520 2.0e-07
psoriasis -1.300 1.2e-04
spina bifida -1.611 3.2e-02

AA Sequence

MYCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNN      1 - 70
CHPTPGLSGINLTTYVQPGCESPCEPRC                                               71 - 98
//

Text Mined References (4)

PMID Year Title