Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.00019973829809E-7
medulloblastoma, large-cell 6234 5.64145151926111E-5
psoriasis 6685 1.24658597074964E-4
adult high grade glioma 2148 2.49262803879406E-4
Atopic dermatitis 944 0.00770909841756316
spina bifida 1064 0.0319890095256133

AA Sequence

MYCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNN      1 - 70
CHPTPGLSGINLTTYVQPGCESPCEPRC                                               71 - 98
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.