Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.15
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.5e-04
Atopic dermatitis 952 3.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.600 3.1e-02
psoriasis -1.100 8.5e-04

AA Sequence

MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNS      1 - 70
CQPTPGLETLNLTTFTQPCCEPCLPRGC                                               71 - 98
//

Text Mined References (8)

PMID Year Title