Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.50
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

AA Sequence

MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCSPSCCQTTC      1 - 70
CRTTCCRPSCCVSSCFRPQCCQSVYCQPTCCRPSCGQTTCCRTTCYRPSCCVSTCCRPTCSSGSCC         71 - 136
//

Text Mined References (6)

PMID Year Title