Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.0e-04
diabetes mellitus 1728 1.7e-02
Disease Target Count Z-score Confidence
Hypopharynx cancer 4 4.516 2.3

Gene RIF (1)

AA Sequence

MVSSCCGSVSSEQSCGLENCCRPSCCQTTCCRTTCCRPSCCKPQCCQSVCYQPTCCHPSCCISSCCRPYC      1 - 70
CESSCCRPCCCQTTCCRTTCCRTTCCCPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSCCHPSCCESSC     71 - 140
CRPCCCVRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC                                 141 - 181
//

Text Mined References (5)

PMID Year Title