Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
Funding $196,380.26
PubMed Score 9.18
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25472883 HIV-1 Tat specifically associates with TRIM34 promoter to upregulate TRIM34 expression in T cells
24314652 HIV-1 Tat specifically associates with TRIM34 promoter to upregulate TRIM34 expression in T cells
24314652 HIV-1 Tat specifically associates with TRIM34 promoter to upregulate TRIM34 expression in T cells
17156811 HIV-1 Tat specifically associates with TRIM34 promoter to upregulate TRIM34 expression in T cells
16828831 HIV-1 Tat specifically associates with TRIM34 promoter to upregulate TRIM34 expression in T cells
16775307 HIV-1 Tat specifically associates with TRIM34 promoter to upregulate TRIM34 expression in T cells

AA Sequence

MASKILLNVQEEVTCPICLELLTEPLSLDCGHSLCRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQA      1 - 70
NQHLANIVERLKEVKLSPDNGKKRDLCDHHGEKLLLFCKEDRKVICWLCERSQEHRGHHTVLTEEVFKEC     71 - 140
QEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTERQRIQTEFDQLRSILNNEEQRELQRLEEEEK    141 - 210
KTLDKFAEAEDELVQQKQLVRELISDVECRSQWSTMELLQDMSGIMKWSEIWRLKKPKMVSKKLKTVFHA    211 - 280
PDLSRMLQMFRELTAVRCYWVDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHY    281 - 350
WEVDVSKKTAWILGVYCRTYSRHMKYVVRRCANRQNLYTKYRPLFGYWVIGLQNKCKYGVFEESLSSDPE    351 - 420
VLTLSMAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWNCPAPMTLCPPSS      421 - 488
//

Text Mined References (12)

PMID Year Title
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
21680743 2011 Determinants of the higher order association of the restriction factor TRIM5alpha and other tripartite motif (TRIM) proteins.
18159944 2007 Discordant evolution of the adjacent antiretroviral genes TRIM22 and TRIM5 in mammals.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17156811 2007 Unique features of TRIM5alpha among closely related human TRIM family members.
16828831 2006 Antiretroviral potential of human tripartite motif-5 and related proteins.
16775307 2006 Functional replacement of the RING, B-box 2, and coiled-coil domains of tripartite motif 5alpha (TRIM5alpha) by heterologous TRIM domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...