Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.18
PubTator Score 1.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.400 0.034
acute myeloid leukemia -1.100 0.024
ovarian cancer 1.500 0.000

Synonym

Accession Q9BYD6 A6NG03 Q4W5B8 Q6IAG4 Q96BW3 Q9H793 Q9NRL5 L1mt
Symbols L1MT
BM022
MRP-L1

Gene

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAAVRCMGRALIHHQRHSLSKMVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEKTPDEKKDEIE      1 - 70
KIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPF     71 - 140
TSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRL    141 - 210
RKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCR    211 - 280
HRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA                             281 - 325
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...