Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.18
PubTator Score 1.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 9.5e-05
acute myeloid leukemia 783 2.4e-02
astrocytic glioma 2597 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.100 2.4e-02
astrocytic glioma -1.400 3.4e-02
ovarian cancer 1.500 9.5e-05

Gene RIF (3)

AA Sequence

MAAAVRCMGRALIHHQRHSLSKMVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEKTPDEKKDEIE      1 - 70
KIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPF     71 - 140
TSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRL    141 - 210
RKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCR    211 - 280
HRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA                             281 - 325
//

Text Mined References (20)

PMID Year Title