Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.06
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.793 0.004
colon cancer 1.100 0.023
lung cancer 1.100 0.002

Synonym

Accession Q9BYD3 A6NNV7 Q9BW07 Q9H4N2 Q9Y317 L4mt
Symbols L4mt
CGI-28

Gene

PDB

3J9M   3J7Y  

Gene RIF (3)

PMID Text
23472126 there is a strong association between allergic rhinitis risk and polymorphisms of MRPL4 and TNF-alpha genes in the Han Chinese population
20877624 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLR      1 - 70
GFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTGRARHGS     71 - 140
IRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLELPTGDPQYLTELAHYR    141 - 210
RWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPAVGLNVHSMLKHQTLVLTLPTVAFLEDKLLWQDSRY    211 - 280
RPLYPFSLPYSDFPRPLPHATQGPAATPYHC                                           281 - 311
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23472126 2013 The association between polymorphisms in the MRPL4 and TNF-? genes and susceptibility to allergic rhinitis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
More...