Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.98
PubTator Score 21.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 1.200 6.7e-07
breast carcinoma 1.500 1.1e-26
ductal carcinoma in situ 1.100 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.700 7.5e-04
invasive ductal carcinoma 1.400 2.9e-03
lung adenocarcinoma 1.117 8.9e-05
lung cancer 1.800 1.5e-03
non-small cell lung cancer 1.080 1.5e-16
ovarian cancer 1.900 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.114 2.8e-02

Synonym

Accession Q9BYD1 B2R4R8 Q9UI04 L13mt
Symbols L13
L13A
L13mt
RPL13
RPML13

Gene

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGN      1 - 70
KWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKN     71 - 140
LVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL                                    141 - 178
//

Text Mined References (21)

PMID Year Title