Property Summary

NCBI Gene PubMed Count 17
Grant Count 64
R01 Count 13
Funding $13,197,201.18
PubMed Score 8.10
PubTator Score 21.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q9BYD1 B2R4R8 Q9UI04 L13mt
Symbols L13
L13A
L13mt
RPL13
RPML13

Gene

PDB

3J9M   3J7Y  

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18995835 DAPK-ZIPK-L13a axis forms a unique regulatory module that first represses, then repermits inflammatory gene expression.

AA Sequence

MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGN      1 - 70
KWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKN     71 - 140
LVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL                                    141 - 178
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25317112 2014 Epidemiological and genome-wide association study of gastritis or gastric ulcer in korean populations.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21531335 2011 MTERF4 regulates translation by targeting the methyltransferase NSUN4 to the mammalian mitochondrial ribosome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20601428 2010 Properties of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L and its interactions with mammalian mitochondrial ribosomes.
18995835 2008 DAPK-ZIPK-L13a axis constitutes a negative-feedback module regulating inflammatory gene expression.
More...