Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.61
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Male infertility 170 3.311 1.7

Expression

Synonym

Accession Q9BYC2 B2RBB4 Q5QPK4 Q8NHR1 Q9H1I4
Symbols SCOTT
FKSG25

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Species Source
Mouse OMA EggNOG
Mouse OMA Inparanoid
Fruitfly OMA Inparanoid

AA Sequence

MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVMIGGFGLCGIP      1 - 70
ENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENTLCESQYLAGELELELTPQGT     71 - 140
LAERIRAGGAGVPAFYTPTGYGTLVQEGGAPIRYTPDGHLALMSQPREVREFNGDHFLLERAIRADFALV    141 - 210
KGWKADRAGNVVFRRSARNFNVPMCKAADVTAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIE    211 - 280
RLTILKEEDGDAGKEEDARTRIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPF    281 - 350
PTEDEVDADLINAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGM    351 - 420
GGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGL    421 - 490
TVDDIKKSTGCAFAVSPNLRPMQQVAP                                               491 - 517
//

Text Mined References (7)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756565 2002 Cloning and characterization of a human orthologue of testis-specific succinyl CoA: 3-oxo acid CoA transferase (Scot-t) cDNA.
11327867 2001 Dimeric pig heart succinate-coenzyme A transferase uses only one subunit to support catalysis.
11214971 2000 Characterization of long cDNA clones from human adult spleen.