Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.61
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Male infertility 206 3.305 1.7

Expression

Synonym

Accession Q9BYC2 B2RBB4 Q5QPK4 Q8NHR1 Q9H1I4
Symbols SCOTT
FKSG25

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

AA Sequence

MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVMIGGFGLCGIP      1 - 70
ENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENTLCESQYLAGELELELTPQGT     71 - 140
LAERIRAGGAGVPAFYTPTGYGTLVQEGGAPIRYTPDGHLALMSQPREVREFNGDHFLLERAIRADFALV    141 - 210
KGWKADRAGNVVFRRSARNFNVPMCKAADVTAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIE    211 - 280
RLTILKEEDGDAGKEEDARTRIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPF    281 - 350
PTEDEVDADLINAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGM    351 - 420
GGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGL    421 - 490
TVDDIKKSTGCAFAVSPNLRPMQQVAP                                               491 - 517
//

Text Mined References (7)

PMID Year Title