Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BY89 B0QYF2 B7ZW08 Q5THZ5
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
21509594 KIAA1671 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.

AA Sequence

MATRVEVGSITPLTAVPGLGEMGKEETLTRTYFLQAGEASGAPPARILEAKSPLRSPARLLPLPRLAPKP      1 - 70
FSKEQDVKSPVPSLRPSSTGPSPSGGLSEEPAAKDLDNRMPGLVGQEVGSGEGPRTSSPLFNKAVFLRPS     71 - 140
SSTMILFETTKSGPALGKAVSEGAEEAKLGVSGSRPEVAAKPALPTQKPAGTLPRSAPLSQDTKPPVPQE    141 - 210
EAGQDHPPSKASSVEDTARPLVEPRPRLKRRPVSAIFTESIQPQKPGPGAAATVGKVPPTPPEKTWVRKP    211 - 280
RPLSMDLTARFENKEALLRKVADEGSGPTAGDMAGLERPRAASKLDRDCLVKAEAPLHDPDLDFLEVAKK    281 - 350
IRERKEKMLSKPEMGSPRALVGGSSGVTPSNDQSPWEEKAKLDPEPEKAAESPSPRLGRGLELAEVKSRV    351 - 420
ADGEAAAGGEWASRRSVRKCISLFREDSTLALAVGSESPLATPASPSAAPEPEKGVVSVQERIRGWTAES    421 - 490
SEAKPEVRRRTFQARPLSADLTKLFSSSASSNEVKYEKSAELSGEFPKEPREKQKEGHSLDGACIPRSPW    491 - 560
KPGTLRDKSRQTEQKVSSNQDPDSCRGGSSVEAPCPSDVTPEDDRSFQTVWATVFEHHVERHTVADQSGR    561 - 630
CLSTTPPGDMAHARVSEPRPRPEMGSWLGRDPPDMTKLKKENSRGFDNPETEKLGPTTLLNGELRPYHTP    631 - 700
LRDKYPLSENHNNNTFLKHLENPPTSQRIEPRYDIVHAVGERVHSEAISPAPEEKAVTLRSLRSWLSLKD    701 - 770
RQLSQEVTPADLECGLEGQAGSVQRASLIWEARGMPEASGPKFGGNCPFPKWTGGAVVSSHKATVAVSEE    771 - 840
HCAPGATSVRAIKAAIWESQHEGPEGARSKPGVGARGPPQGCPLDPLSRATNGPSDSQARTHPDAFAVQK    841 - 910
GPFIVAAREGDPGPAQVPQPAVRMRKAGAMDQRMDRWRRRTLPPNVKFDTFSSLVPEDSPHVGHRRTDYV    911 - 980
SPTASALRKPQLSHYRVETQEVNPGASRDQTSPAVKQGSPVEPKATFFAVTYQIPNTQKAKGVVLSGAES    981 - 1050
LLEHSRKITPPSSPHSLTSTLVSLGHEEALEMAGSKNWMKGREHENASILKTLKPTDRPSSLGAWSLDPF   1051 - 1120
NGRIIDVDALWSHRGSEDGPRPQSNWKESANKMSPSGGAPQTTPTLRSRPKDLPVRRKTDVISDTFPGKI   1121 - 1190
RDGYRSSVLDIDALMAEYQELSLKVPGEAQERRSPTVEPSTLPRERPVQLGGVEQRRRSLKEMPDTGGLW   1191 - 1260
KPASSAEINHSFTPGLGKQLAETLETAMGTKSSPPFWALPPSAPSERYPGGSPIPADPRKKTGFAEDDRK   1261 - 1330
AFASKHHVAKCQNYLAESKPSGREDPGSGVRVSPKSPPTDQKKGTPRKSTGRGEEDSVAQWGDHPRDCGR   1331 - 1400
VPLDIKRAYSEKGPPANIREGLSIMHEARERRREQPKGRPSLTGENLEAKMGPCWWESGTGDSHKVLPRD   1401 - 1470
LEKEDAPQEKERPLQQVSPVASVPWRSHSFCKDRRSGPFVDQLKQCFSRQPTEPKDTDTLVHEAGSQYGT   1471 - 1540
WTEQCQSGESLATESPDSSATSTRKQPPSSRLSSLSSQTEPTSAGDQYDCSRDQRSTSVDHSSTDLESTD   1541 - 1610
GMEGPPPPDACPEKRVDDFSFIDQTSVLDSSALKTRVQLSKRSRRRAPISHSLRRSRFSESESRSPLEDE   1611 - 1680
TDNTWMFKDSTEEKSPRKEESDEEETASKAERTPVSHPQRMPAFPGMDPAVLKAQLHKRPEVDSPGETPS   1681 - 1750
WAPQPKSPKSPFQPGVLGSRVLPSSMDKDERSDEPSPQWLKELKSKKRQSLYENQV                 1751 - 1806
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15289310 2004 Autoantibodies to Annexin XI-A and Other Autoantigens in the Diagnosis of Breast Cancer.
More...