Property Summary

NCBI Gene PubMed Count 163
PubMed Score 549.72
PubTator Score 324.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.300 2.4e-04
aldosterone-producing adenoma 1.191 3.9e-02
atypical teratoid/rhabdoid tumor 1.200 2.1e-04
Breast cancer 2.900 4.1e-02
colon cancer -1.500 4.1e-02
cutaneous lupus erythematosus -1.200 2.4e-02
Gaucher disease type 1 -1.600 2.5e-02
group 3 medulloblastoma 1.200 5.6e-03
intraductal papillary-mucinous adenoma (... -1.800 2.1e-02
intraductal papillary-mucinous carcinoma... -1.400 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.500 1.8e-02
invasive ductal carcinoma 1.551 3.2e-04
lung adenocarcinoma -1.600 1.6e-05
lung cancer 1.400 9.4e-04
malignant mesothelioma 3.500 2.2e-08
medulloblastoma, large-cell 1.100 1.4e-02
non-small cell lung cancer -1.380 1.1e-08
osteosarcoma 3.680 1.2e-04
ovarian cancer -1.300 4.7e-03
pituitary cancer 1.100 5.5e-05
psoriasis 1.100 1.1e-03
ulcerative colitis 1.500 1.3e-03

Protein-protein Interaction (2)

Gene RIF (147)

AA Sequence

MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSD      1 - 70
DSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITV     71 - 140
LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVH    141 - 210
KEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTW    211 - 280
VRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTT    281 - 350
TTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA    351 - 420
DTAIINAEGGQNNSEEKKEYFI                                                    421 - 442
//

Text Mined References (171)

PMID Year Title