Property Summary

NCBI Gene PubMed Count 149
Grant Count 143
R01 Count 83
Funding $22,891,691.67
PubMed Score 508.31
PubTator Score 324.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BY67 A4FVB5 F5H0J4 H0YGA7 H1ZZV9 H1ZZW1 H1ZZW2 Q86WB8 Q8N2F4 X5D2C8
Symbols BL2
ST17
IGSF4
NECL2
RA175
TSLC1
IGSF4A
Necl-2
SYNCAM
sgIGSF
sTSLC-1
synCAM1

Gene

PANTHER Protein Class (1)

PDB

4H5S   3BIN  

Gene RIF (134)

PMID Text
26772392 This study revealed that Merkel cell polyomavirus -negative Merkel cell carcinomas significantly expressed higher CADM1 and lower MAL than Merkel cell polyomavirus -positive Merkel cell carcinomas
26687224 SynCAM1 delineates the postsynaptic perimeter of the synaptic cleft as determined by immunoelectron microscopy.
26552048 Hypermethylation of CADM1 gene may be highly associated with the development of cervical cancer.
26473640 The use of CADM1, MAL, and MIR124-2 as biomarkers for full molecular screening in HIV infected women who are also positive for human papillomavirus.
26464628 Our study showed that miR-126, by down-regulation CADM1, enhances migration and invasion in gastric cancer cells.
26463893 CADM1 deletion is associated with neuroblastoma and ganglioneuroma.
26259600 increased CADM1 shedding appeared to contribute to the development of emphysema by generating alphaCTF and the ICD in lung epithelial cells.
26231557 CADM1 shedding is increased in idiopathic interstitial pneumonia and contributes to alveolar epithelial cell apoptosis.
26219541 CADM1/MAL methylation increases with severity of cervical intraepithelial neoplasia
25845528 Results show that CADM1 is downregulated in HPV-positive cervical cancers and that epigenetic alteration of CADM1 was more frequent in this type of cancer. The restoration of CADM1 expression may be a potential strategy for cervical cancer therapy.
More...

AA Sequence

MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSD      1 - 70
DSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITV     71 - 140
LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVH    141 - 210
KEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTW    211 - 280
VRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTT    281 - 350
TTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA    351 - 420
DTAIINAEGGQNNSEEKKEYFI                                                    421 - 442
//

Text Mined References (157)

PMID Year Title
26772392 2016 Lower expression of CADM1 and higher expression of MAL in Merkel cell carcinomas are associated with Merkel cell polyomavirus infection and better prognosis.
26687224 2015 Topographic Mapping of the Synaptic Cleft into Adhesive Nanodomains.
26552048 2016 Methylation of Cervical Neoplastic Cells Infected With Human Papillomavirus 16.
26473640 2015 Methylation Levels of CADM1, MAL, and MIR124-2 in Cervical Scrapes for Triage of HIV-Infected, High-Risk HPV-Positive Women in Kenya.
26464628 2015 MicroRNA-126 regulates migration and invasion of gastric cancer by targeting CADM1.
26463893 2016 Coexistence of neuroblastoma and ganglioneuroma in a girl with a hemizygous deletion of chromosome 11q14.1-23.3.
26259600 2015 The intracellular domain of cell adhesion molecule 1 is present in emphysematous lungs and induces lung epithelial cell apoptosis.
26231557 2015 Increased ectodomain shedding of cell adhesion molecule 1 as a cause of type II alveolar epithelial cell apoptosis in patients with idiopathic interstitial pneumonia.
26219541 2016 CADM1 and MAL methylation status in cervical scrapes is representative of the most severe underlying lesion in women with multiple cervical biopsies.
25845528 2015 Hypermethylation of the tumor-suppressor cell adhesion molecule 1 in human papillomavirus-transformed cervical carcinoma cells.
More...