Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BY65 Q8NG33 NPCDRG
Symbols NPCR
NPCDRG

Gene

 Compartment GO Term (0)

AA Sequence

MPTVKTRKLNSLELTYLAQGHTMSEWGNLDMDFSLPELRADQRLCLNFQDPFLPLVDAHGIEKCRAFSFS      1 - 70
VEKFCLPLVMKGILQKGVSPLNSSIDYGRLAKKESL                                       71 - 106
//

Text Mined References (1)

PMID Year Title
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.