Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.86
PubTator Score 11.61

Knowledge Summary

Patent (3,246)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -5.000 0.000
esophageal adenocarcinoma -2.700 0.023
psoriasis 1.200 0.002
non-small cell lung cancer 3.792 0.000
pancreatic cancer 1.700 0.001
interstitial cystitis -2.400 0.003
lung adenocarcinoma 1.300 0.000
Breast cancer -2.600 0.000

Gene RIF (7)

PMID Text
26473854 knockdown of GPR87 led to a p53-dependent signal transduction and caused apoptosis in the bladder cancer cells.
23752273 This study aimed to clarify the role of GPR87 in urothelial carcinoma of the bladder.
23593389 GPR87 promotes the growth and metastasis of CD133(+) cancer stem-like cells, and our findings may reveal new targets for HCC prevention or therapy
19602589 GPR87 knockdown sensitized cancer cells to DNA damage-induced growth suppression via enhanced p53 stabilization and activation.
18183596 Human GPR87 mRNA transcript was preferentially overexpressed in squamous cell carcinomas. Up-regulation of both, transcript and protein, was detected in samples of SCC of the lung, cervix, skin and head and neck (pharynx, larynx and epiglottis).
18057535 G-protein coupled receptor(GPR87) stands out as a candidate for further target validation due to its marked overexpression and correlation on a mutation-based level to squamous cell carcinoma
17905198 Results suggest that the GPR87 is a LPA receptor which evolved from a common ancestor of P2Y receptors.

AA Sequence

MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLNGLAVWIFFHI      1 - 70
RNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVLFYANMYTSIVFLGLISIDRY     71 - 140
LKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILTNGQPTEDNIHDCSKLKSPLGVKWHTAVTYV    141 - 210
NSCLFVAVLVILIGCYIAISRYIHKSSRQFISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHL    211 - 280
DRLLDESAQKILYYCKEITLFLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVR    281 - 350
IYYDYTDV                                                                  351 - 358
//

Text Mined References (14)

PMID Year Title
26473854 2015 G Protein-Coupled Receptor 87 (GPR87) Promotes Cell Proliferation in Human Bladder Cancer Cells.
23752273 2013 Expression and role of GPR87 in urothelial carcinoma of the bladder.
23593389 2013 G protein-coupled receptor 87 (GPR87) promotes the growth and metastasis of CD133? cancer stem-like cells in hepatocellular carcinoma.
19602589 2009 The G protein-coupled receptor 87 is necessary for p53-dependent cell survival in response to genotoxic stress.
18183596 2008 hGPR87 contributes to viability of human tumor cells.
18057535 2008 GPR87 is an overexpressed G-protein coupled receptor in squamous cell carcinoma of the lung.
17905198 2007 The orphan GPCR GPR87 was deorphanized and shown to be a lysophosphatidic acid receptor.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...