Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.84
PubTator Score 10.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.600 9.3e-04
Astrocytoma, Pilocytic 1.900 1.0e-05
Breast cancer -1.400 4.6e-02
breast carcinoma -1.100 3.9e-03
COPD -1.100 2.9e-02
cystic fibrosis -2.571 4.7e-07
fibroadenoma -1.300 2.5e-02
gastric cancer -1.200 2.1e-02
glioblastoma 1.500 2.1e-05
invasive ductal carcinoma -1.200 9.6e-03
lung cancer -1.500 2.0e-03
lung carcinoma -1.300 7.8e-18
malignant mesothelioma 2.300 3.1e-08
medulloblastoma, large-cell 1.300 5.2e-03
osteosarcoma -1.499 8.7e-04
ovarian cancer -2.400 4.4e-07
pancreatic cancer -1.300 1.6e-02
pancreatic carcinoma -1.300 1.6e-02
pituitary cancer 1.500 1.7e-02
primary pancreatic ductal adenocarcinoma 1.137 1.2e-02
psoriasis -1.200 2.1e-03
subependymal giant cell astrocytoma 3.822 2.3e-02
ulcerative colitis 1.500 4.6e-07

Gene RIF (9)

AA Sequence

MWQPRRPWPRVPWRWALALLALVGAGLCHAGPQPGYPARPSARNKNWCAYIVNKNVSCSVLEGSESFIQA      1 - 70
QYNCAWNQMPCPSALVYRVNFRPRYVTRYKTVTQLEWRCCPGFRGGDCQEGPKDPVKTLRPTPARPRNSL     71 - 140
KKATDNEPSQFSEPRKTLSPTGTAQPSWGVDPKEGPQELQEKKIQVLEEKVLRLTRTVLDLQSSLAGVSE    141 - 210
NLKHATQDDASRTRAPGLSSQHPKPDTTVSGDTETGQSPGVFNTKESGMKDIKSELAEVKDTLKNKSDKL    211 - 280
EELDGKVKGYEGQLRQLQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLTG    281 - 350
LQQQCDDYGSSYLGVIELIGEKETSLRKEINNLRARLQEPSAQANCCDSEKNGDIGQQIKTLDQKIERVA    351 - 420
EATRMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLV    421 - 490
DQKIQSLEDRLGSVLLQMTNNTGAELSPPGAAALPGVSGSGDERVMMELNHLKDKVQVVEDICLLNIQGK    491 - 560
PHGMEGALPNREDRAVRDSLHLLKSLNDTMHRKFQETEQTIQKLQQDFSFLYSQLNHTENDVTHLQKEMS    561 - 630
NCRAGENAGMGRFTKVGEQERTVDTLPSPQHPVAHCCSQLEERWQRLQSQVISELDACKECTQGVQREVS    631 - 700
MVEGRVSHMEKTCSKLDSISGNLQRIKEGLNKHVSSLWNCVRQMNGTLRSHSRDISGLKNSVQQFYSHVF    701 - 770
QISTDLQDLVKFQPSAKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERPPQPPG    771 - 840
STGVIAETGQAGPPAGAGVSGRGLPRGVDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGAPVPSLVSFSA    841 - 910
GLTQKPFPSDGGVVLFNKVLVNDGDVYNPSTGVFTAPYDGRYLITATLTPERDAYVEAVLSVSNASVAQL    911 - 980
HTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAVNVVVTGGKLAHTDFDEMYSTFSGVFLYPFL    981 - 1050
SHL                                                                      1051 - 1053
//

Text Mined References (18)

PMID Year Title