Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.27
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q9BXU2 Q5JYF6
Symbols TGC3B
TSGA5

Gene

 Compartment GO Term (1)

AA Sequence

MALRPEDPSSGFRHGNVVAFIIEKMARHTKGPEFYFENISLSWEEVEDKLRAILEDSEVPSEVKEACTWG      1 - 70
SLALGVRFAHRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQ     71 - 140
RERDMLRWKLFHAELAPPQGQGQATVFPGLATAGGDWTEGAGEQEKEAVAAAGAAGGKGEERYAEAGPAP    141 - 210
AEVLQGLGGGFRQPLGAIVAGKLHLCGAEGERSQVSTNSHVCLLWAWVHSLTGASSCPAPYLIHILIPMP    211 - 280
FVRLLSHTQYTPFTSKGHRTGSNSDAFQLGGL                                          281 - 312
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
14531651 2003 Molecular and cytogenetic characterization of two azoospermic patients with X-autosome translocation.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.