Property Summary

NCBI Gene PubMed Count 18
Grant Count 31
R01 Count 16
Funding $4,773,547.08
PubMed Score 27.47
PubTator Score 21.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26839278 NuSAP governs chromosome oscillation via regulation of Kid, facilitating the Kid-generated polar ejection force. Depletion of NuSAP significantly suppresses the amplitude and velocity of chromosome oscillation.
26554377 NUSAP1 may be a crucial biomarker for oral squamous cell carcinoma. down-regulated NUSAP1 expression suppresses tumor proliferation and also enhances anti-tumor effect of paclitaxel by activating apoptotic pathways.
26485712 High levels of NuSAP1 expression were related to poor disease-free survival, particularly in triple-negative breast cancer.
24521615 A novel association between BRCA1 and NUSAP1 is revealed and a mechanism whereby NUSAP1 is involved in carcinogenesis was elusidated.
23405241 High NUSAP1 expression is associated with cervical cancer.
22349817 NuSAP is a novel biomarker for prostate cancer recurrence after surgery and its overexpression appears to be driven in part by E2F1 activation
22101338 Phosphorylation of NuSAP by Cdk1 is an important mechanism to regulate microtubule dynamics during cell cycle progression.
21782797 Interphase NuSAP-chromatin interaction suggests additional functions for NuSAP, as recently identified for other nuclear spindle assembly factors with a role in gene expression or DNA damage response.
20053754 NuSAP1 is recognized as an immunogenic antigen in 65% of patients with AML following allogeneic HCT and suggests a tumor antigen role.

AA Sequence

MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQ      1 - 70
ISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDLRATAKVPSPPDEH     71 - 140
QEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAHFKEMESIDQYIERKKKHF    141 - 210
EEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKT    211 - 280
GVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTP    281 - 350
VSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ    351 - 420
ERKEKKAKVLGMRRGLILAED                                                     421 - 441
//

Text Mined References (32)

PMID Year Title
26839278 2016 NuSAP governs chromosome oscillation by facilitating the Kid-generated polar ejection force.
26554377 2015 Down-Regulation of Nucleolar and Spindle-Associated Protein 1 (NUSAP1) Expression Suppresses Tumor and Cell Proliferation and Enhances Anti-Tumor Effect of Paclitaxel in Oral Squamous Cell Carcinoma.
26485712 2015 High Levels of Nucleolar Spindle-Associated Protein and Reduced Levels of BRCA1 Expression Predict Poor Prognosis in Triple-Negative Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24521615 2014 NUSAP1 influences the DNA damage response by controlling BRCA1 protein levels.
23405241 2013 Mitosis is a source of potential markers for screening and survival and therapeutic targets in cervical cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22349817 2013 Increased expression of NuSAP in recurrent prostate cancer is mediated by E2F1.
More...