Property Summary

NCBI Gene PubMed Count 20
PubMed Score 31.09
PubTator Score 21.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (36)

Disease log2 FC p
adrenocortical carcinoma 1.237 1.1e-02
adult high grade glioma 3.200 1.1e-05
astrocytoma 1.900 6.2e-11
Astrocytoma, Pilocytic 1.600 2.5e-05
Atopic dermatitis 1.700 1.5e-06
atypical teratoid / rhabdoid tumor 4.200 2.8e-13
Breast cancer 4.200 2.2e-02
breast carcinoma 2.700 6.7e-49
chronic rhinosinusitis 1.273 2.5e-03
colon cancer 1.300 9.1e-03
cystic fibrosis and chronic rhinosinusit... 1.473 6.2e-03
ductal carcinoma in situ 3.500 3.2e-04
Endometriosis 2.251 7.2e-03
ependymoma 1.200 4.4e-02
glioblastoma 3.900 2.2e-13
group 3 medulloblastoma 4.700 6.7e-09
interstitial cystitis 2.700 4.9e-03
intraductal papillary-mucinous carcinoma... 3.900 1.5e-04
intraductal papillary-mucinous neoplasm ... 4.600 1.3e-03
invasive ductal carcinoma 3.800 1.3e-04
lung adenocarcinoma 1.100 3.3e-08
lung cancer 3.600 3.7e-06
malignant mesothelioma 1.100 1.3e-05
medulloblastoma, large-cell 4.600 8.9e-08
nasopharyngeal carcinoma 1.600 1.7e-05
non-small cell lung cancer 3.138 1.4e-28
oligodendroglioma 2.000 1.4e-08
ovarian cancer 1.700 4.3e-03
pancreatic cancer 1.700 4.1e-06
pancreatic ductal adenocarcinoma liver m... 2.053 1.2e-02
pituitary cancer 3.200 4.9e-08
primary Sjogren syndrome 2.300 2.4e-04
primitive neuroectodermal tumor 4.500 5.9e-08
psoriasis 1.100 2.1e-05
ulcerative colitis 1.100 2.4e-04
Waldenstrons macroglobulinemia 1.951 3.7e-02

Gene RIF (11)

AA Sequence

MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQ      1 - 70
ISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDLRATAKVPSPPDEH     71 - 140
QEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAHFKEMESIDQYIERKKKHF    141 - 210
EEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKT    211 - 280
GVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTP    281 - 350
VSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ    351 - 420
ERKEKKAKVLGMRRGLILAED                                                     421 - 441
//

Text Mined References (34)

PMID Year Title