Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.47
PubTator Score 21.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
breast carcinoma 1614 6.73318258953181E-49
non-small cell lung cancer 2798 1.36214719306769E-28
psoriasis 6685 8.01139423697344E-15
atypical teratoid / rhabdoid tumor 4369 2.76249355930881E-13
sonic hedgehog group medulloblastoma 1482 1.34076965560568E-12
astrocytoma 1493 6.21715017108517E-11
pediatric high grade glioma 2712 3.73021339757594E-9
oligodendroglioma 2849 1.42673942896057E-8
posterior fossa group A ependymoma 1511 2.3516492829524E-8
pituitary cancer 1972 4.93992529350592E-8
primitive neuroectodermal tumor 3031 5.85477322059323E-8
medulloblastoma, large-cell 6234 8.8751772789528E-8
lung cancer 4473 3.63870950867354E-7
glioblastoma 5572 5.03270663565889E-7
Atopic dermatitis 944 1.45639993046264E-6
malignant mesothelioma 3163 1.69658136151498E-6
pancreatic cancer 2300 4.09227497406947E-6
lung adenocarcinoma 2714 1.08205997454266E-5
nasopharyngeal carcinoma 1056 1.72346948136376E-5
pilocytic astrocytoma 3086 2.46609738053779E-5
invasive ductal carcinoma 2950 1.26545004333295E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.48321229543215E-4
ulcerative colitis 2087 2.39455331393779E-4
primary Sjogren syndrome 789 2.41342189529418E-4
ductal carcinoma in situ 1745 3.2287534528281E-4
ovarian cancer 8492 3.4768259609717E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00129043054328752
chronic rhinosinusitis 512 0.00250196725386661
interstitial cystitis 2299 0.0049179563492456
cystic fibrosis and chronic rhinosinusitis 213 0.00618457030559352
Endometriosis 535 0.00717862062753401
adrenocortical carcinoma 1427 0.0106753133686439
colon cancer 1475 0.0107294522735968
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0119086146505014
Breast cancer 3099 0.0215258560780546
Waldenstrons macroglobulinemia 765 0.0368768224631611

Expression

Synonym

Accession Q9BXS6 B4DDF1 E7ERR5 J3KN21 Q53GW2 Q8TBT4 Q96E58 Q96FJ1 Q9GZM9 Q9NZ85 Q9UI70 NuSAP
Symbols LNP
ANKT
SAPL
BM037
NUSAP
Q0310
PRO0310p1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (9)

PMID Text
26839278 NuSAP governs chromosome oscillation via regulation of Kid, facilitating the Kid-generated polar ejection force. Depletion of NuSAP significantly suppresses the amplitude and velocity of chromosome oscillation.
26554377 NUSAP1 may be a crucial biomarker for oral squamous cell carcinoma. down-regulated NUSAP1 expression suppresses tumor proliferation and also enhances anti-tumor effect of paclitaxel by activating apoptotic pathways.
26485712 High levels of NuSAP1 expression were related to poor disease-free survival, particularly in triple-negative breast cancer.
24521615 A novel association between BRCA1 and NUSAP1 is revealed and a mechanism whereby NUSAP1 is involved in carcinogenesis was elusidated.
23405241 High NUSAP1 expression is associated with cervical cancer.
22349817 NuSAP is a novel biomarker for prostate cancer recurrence after surgery and its overexpression appears to be driven in part by E2F1 activation
22101338 Phosphorylation of NuSAP by Cdk1 is an important mechanism to regulate microtubule dynamics during cell cycle progression.
21782797 Interphase NuSAP-chromatin interaction suggests additional functions for NuSAP, as recently identified for other nuclear spindle assembly factors with a role in gene expression or DNA damage response.
20053754 NuSAP1 is recognized as an immunogenic antigen in 65% of patients with AML following allogeneic HCT and suggests a tumor antigen role.

AA Sequence

MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQ      1 - 70
ISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDLRATAKVPSPPDEH     71 - 140
QEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAHFKEMESIDQYIERKKKHF    141 - 210
EEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKT    211 - 280
GVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTP    281 - 350
VSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ    351 - 420
ERKEKKAKVLGMRRGLILAED                                                     421 - 441
//

Text Mined References (32)

PMID Year Title
26839278 2016 NuSAP governs chromosome oscillation by facilitating the Kid-generated polar ejection force.
26554377 2015 Down-Regulation of Nucleolar and Spindle-Associated Protein 1 (NUSAP1) Expression Suppresses Tumor and Cell Proliferation and Enhances Anti-Tumor Effect of Paclitaxel in Oral Squamous Cell Carcinoma.
26485712 2015 High Levels of Nucleolar Spindle-Associated Protein and Reduced Levels of BRCA1 Expression Predict Poor Prognosis in Triple-Negative Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24521615 2014 NUSAP1 influences the DNA damage response by controlling BRCA1 protein levels.
23405241 2013 Mitosis is a source of potential markers for screening and survival and therapeutic targets in cervical cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22349817 2013 Increased expression of NuSAP in recurrent prostate cancer is mediated by E2F1.
More...