Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.71
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9BXS4 B3KQL7 O75393 Q4VBP9 Q5T705 Q96KX7
Symbols DCF1
C1orf8
PRO195
UNQ169
HSPC001

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
22451312 The TMEM59 gene identified from our discovery approach was recently implicated in amyloid-beta protein precursor post-translational processing, supporting a role for epigenetic change in LOAD pathology.
20427278 TMEM59 affects amyloid precursor protein shedding by reducing its acccess to cellular components.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC      1 - 70
QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL     71 - 140
LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYL    141 - 210
QMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDL    211 - 280
EFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI                               281 - 323
//

Text Mined References (19)

PMID Year Title
25663231 2015 PARK10 is a major locus for sporadic neuropathologically confirmed Parkinson disease.
24928548 2014 Gene expression analysis in MCF-7 breast cancer cells treated with recombinant bromelain.
24424470 2014 Overexpression of DCF1 inhibits glioma through destruction of mitochondria and activation of apoptosis pathway.
23376921 2013 TMEM59 defines a novel ATG16L1-binding motif that promotes local activation of LC3.
22482075 2012 Analyzing microarray data of Alzheimer's using cluster analysis to identify the biomarker genes.
22451312 2012 Genome-wide DNA methylation differences between late-onset Alzheimer's disease and cognitively normal controls in human frontal cortex.
22336716 2012 MicroRNA-351 regulates TMEM 59 (DCF1) expression and mediates neural stem cell morphogenesis.
20427278 2010 The novel membrane protein TMEM59 modulates complex glycosylation, cell surface expression, and secretion of the amyloid precursor protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...