Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.41
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 2.9e-06
Breast cancer 2.600 2.8e-02
cystic fibrosis -1.573 1.1e-05
ependymoma -1.200 1.2e-07
glioblastoma -1.200 2.5e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.8e-03
lung adenocarcinoma -1.200 8.5e-09
medulloblastoma, large-cell -1.200 1.0e-03
oligodendroglioma -1.100 8.1e-03
ovarian cancer -1.900 9.1e-09
pancreatic ductal adenocarcinoma liver m... -1.619 1.6e-02
Rheumatoid arthritis 1.800 1.2e-03
tuberculosis and treatment for 6 months 1.100 4.3e-05
ulcerative colitis -1.200 3.7e-03

 GO Function (1)

Gene RIF (3)

AA Sequence

MAAPKGSLWVRTQLGLPPLLLLTMALAGGSGTASAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC      1 - 70
QRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHL     71 - 140
LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYL    141 - 210
QMRNSQAHRNFLEDGESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCATVATAVEQYVPSEKLSIYGDL    211 - 280
EFMNEQKLNRYPASSLVVVRSKTEDHEEAGPLPTKVNLAHSEI                               281 - 323
//

Text Mined References (20)

PMID Year Title