Property Summary

NCBI Gene PubMed Count 93
Grant Count 197
R01 Count 108
Funding $26,103,500.88
PubMed Score 422.16
PubTator Score 206.11

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BXN2 B2R861 B7Z494 B7Z5A9 B7Z5B9 Q6IPS7 Q96D32 Q96DR9 Q96LD3 Q96PA4 Q96PA5 Q96PA6 Q96PA7 Q96PA8 Q9H1K3
Symbols BGR
CD369
CANDF4
SCARE2
DECTIN1
CLECSF12

Gene

Gene RIF (74)

PMID Text
26963514 TREM-1 and Dectin-1 function concurrently in the corneal innate immune response by regulating inflammatory cytokine expression in fungal keratitis.
26963509 study represents the first analysis demonstrating that harbouring polymorphisms of Dectin-1 (rs7309123) or TLR2 (rs5743708) represents an independent risk factor of developing IFD in patients with AML undergoing induction chemotherapy.
26352598 Our data suggest that the genetic diversity of CLEC7A gene influences the autism spectrum disorders (ASD) phenotype by behaving as a disease specifier and imply that the genetic control of innate immune response could determine the ASD phenotype.
26156997 This study demonstrated that Toll-Like Receptors and Dectin-1, a C-Type Lectin Receptor, Trigger Divergent Functions in CNS Macrophages.
26123355 this study provides novel and opposing functions of hDectin-1 expressed on the two major human DC subsets, pDCs and mDCs
25883525 The analysis of Dectin-1 gene polymorphisms showed no significant association with fungal keratitis in the northern Han Chinese population.
25461401 Data indicate that Candida albicans beta-Glucan induces high IL-1 receptor antagonist (IL-1Ra) levels, independently from Dectin-1/complement receptor 3 (CR3).
25267792 CARD9 regulates H-Ras activation by linking Ras-GRF1 to H-Ras, which mediates Dectin-1-induced extracellular signal-regulated protein kinase (ERK) activation and proinflammatory responses when stimulated by their ligands.
25251945 IECs may respond to beta-glucans by the secretion of pro-inflammatory chemokines in a Dectin-1- and Syk-dependent pathway
25161190 Dectin-1 expressed on human pulmonary epithelial cells has a considerable impact on the Nontypeable Haemophilus influenzae triggered immune response.
More...

AA Sequence

MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIW      1 - 70
RSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNS     71 - 140
WDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTT    141 - 210
ATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM                                     211 - 247
//

Text Mined References (96)

PMID Year Title
26963514 2016 Inhibition of TREM-1 and Dectin-1 Alleviates the Severity of Fungal Keratitis by Modulating Innate Immune Responses.
26963509 2016 Polymorphisms of Dectin-1 and TLR2 Predispose to Invasive Fungal Disease in Patients with Acute Myeloid Leukemia.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26352598 2015 Dectin-1 Polymorphism: A Genetic Disease Specifier in Autism Spectrum Disorders?
26156997 2015 Toll-Like Receptors and Dectin-1, a C-Type Lectin Receptor, Trigger Divergent Functions in CNS Macrophages.
26123355 2015 Opposing Roles of Dectin-1 Expressed on Human Plasmacytoid Dendritic Cells and Myeloid Dendritic Cells in Th2 Polarization.
25883525 2015 Association of Dectin-1 and DC-SIGN gene single nucleotide polymorphisms with fungal keratitis in the northern Han Chinese population.
25461401 2015 An anti-inflammatory property of Candida albicans ?-glucan: Induction of high levels of interleukin-1 receptor antagonist via a Dectin-1/CR3 independent mechanism.
25416956 2014 A proteome-scale map of the human interactome network.
25267792 2014 CARD9 mediates Dectin-1-induced ERK activation by linking Ras-GRF1 to H-Ras for antifungal immunity.
More...