Property Summary

NCBI Gene PubMed Count 100
PubMed Score 467.47
PubTator Score 206.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma -1.319 1.2e-02
adult high grade glioma 1.100 4.3e-04
astrocytoma 2.600 4.2e-03
Astrocytoma, Pilocytic 1.400 9.7e-08
Atopic dermatitis 1.400 1.6e-02
chronic lymphosyte leukemia -1.100 4.8e-07
chronic rhinosinusitis 1.012 2.6e-03
cutaneous lupus erythematosus 1.500 1.1e-02
dermatomyositis 1.100 9.2e-03
ductal carcinoma in situ 1.800 1.3e-03
ependymoma 1.500 1.9e-05
gastric cancer -1.200 3.6e-04
glioblastoma 1.800 1.1e-05
head and neck cancer and chronic obstruc... 1.300 1.4e-02
interstitial cystitis 1.400 3.7e-03
intraductal papillary-mucinous adenoma (... -1.900 3.1e-03
intraductal papillary-mucinous carcinoma... -2.200 1.1e-03
invasive ductal carcinoma 1.208 1.7e-03
lung cancer -3.400 2.4e-06
lung carcinoma -2.600 5.6e-26
malignant mesothelioma 3.200 3.0e-07
mucosa-associated lymphoid tissue lympho... 1.928 1.5e-02
non-small cell lung cancer -1.270 2.0e-07
oligodendroglioma -1.300 4.2e-02
ovarian cancer -1.900 1.1e-04
primary Sjogren syndrome 1.500 2.9e-05
psoriasis 2.100 8.6e-11
subependymal giant cell astrocytoma 2.756 2.7e-02
tuberculosis 1.400 7.2e-04
ulcerative colitis 2.300 5.7e-04

Gene RIF (81)

AA Sequence

MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIW      1 - 70
RSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNS     71 - 140
WDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTT    141 - 210
ATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM                                     211 - 247
//

Text Mined References (103)

PMID Year Title