Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
R01 Count 2
Funding $323,013
PubMed Score 20.62
PubTator Score 18.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.009
pancreatic cancer 1.500 0.023
osteosarcoma -7.103 0.000
pancreatic carcinoma 1.500 0.023
acute myeloid leukemia -2.200 0.034

Synonym

Accession Q9BXL5 Q6XAR3 Q86XY5 Q9NPC0
Symbols NDR
EDAG
CT155
EDAG-1

Gene

 Grant Application (2)

Gene RIF (9)

PMID Text
24740910 EDAG forms complex with GATA1 and p300 and increases GATA1 acetylation and transcriptional activity by facilitating the interaction between GATA1 and p300
22712502 EDAG enhances the protein stability of NPM1 via binding to NPM1, which plays a critical role in the anti-apoptosis of leukaemia cells.
20564185 EDAG functions as a positive regulator of erythroid/megakaryocytic differentiation in 32D cells associated with the induction of GATA-1 and its target genes
19779022 Observational study of gene-disease association. (HuGE Navigator)
18599389 The inhibition of the EDAG gene by PMA is mediated through down-regulation of transcription factor GATA-1 .
17671716 The stable transfected cells were identified with RT-PCR and the effect of EDAG/siRNA on the growth of the human erythroleukemia cell line HEL was analyzed.
16437149 Hemgn promoter contains critical regulatory elements for its transcription in hematopoietic tissues and Hemgn is a direct target of GATA1 in leukemia cells
15332117 These results suggest that EDAG regulates the proliferation and differentiation of hematopoietic cells and resists cell apoptosis through the activation of NF-kappa B.
14730214 results suggest a novel function of nuclear negative differentiation regulator (NDR) protein in regulating hematopoietic cell development [NDR]

AA Sequence

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK      1 - 70
GNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQES     71 - 140
NIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISV    141 - 210
IQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAE    211 - 280
PEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSE    281 - 350
DYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPK    351 - 420
ECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF          421 - 484
//

Text Mined References (23)

PMID Year Title
24740910 2014 EDAG positively regulates erythroid differentiation and modifies GATA1 acetylation through recruiting p300.
23436708 2013 Scanning of novel cancer/testis proteins by human testis proteomic analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22712502 2012 Erythroid differentiation-associated gene interacts with NPM1 (nucleophosmin/B23) and increases its protein stability, resisting cell apoptosis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20564185 2010 Over-expression of EDAG in the myeloid cell line 32D: induction of GATA-1 expression and erythroid/megakaryocytic phenotype.
20350937 2010 The FOXE1 locus is a major genetic determinant for radiation-related thyroid carcinoma in Chernobyl.
19779022 2009 FOXE1 association with both isolated cleft lip with or without cleft palate, and isolated cleft palate.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
More...