Property Summary

NCBI Gene PubMed Count 27
Grant Count 56
R01 Count 18
Funding $10,189,506.04
PubMed Score 224.90
PubTator Score 57.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus -1.300 0.008
Atopic dermatitis -1.200 0.000
lung cancer -1.200 0.011
pilocytic astrocytoma 1.100 0.002
posterior fossa group B ependymoma 1.800 0.000
invasive ductal carcinoma 1.668 0.003
ovarian cancer 2.200 0.014

Gene RIF (19)

PMID Text
26997632 CTRP3 overexpression altered chemokine levels and attenuated systemic inflammation in the setting of obesity.
26656444 CTRP3 is present in cord blood and might be involved in fetal growth
26222183 Lower Circulating C1q/TNF-Related Protein-3 (CTRP3) Levels Are Associated with Obesity
26073386 plasma CTRP-3 is strongly associated with glucose and lipid metabolism, chronic inflammation, and insulin resistance.
25409499 Results show that cartonectin may serve as a novel biomarker for the prediction and early diagnosis of type 2 diabetes mellitus patients.
25185846 CTRP3 could improve insulin sensitivity of insulin resistant 3T3-L1 adipocytes by decreasing inflammation and ameliorating insulin signalling transduction, indicating that CTRP3 may be a new target for the prevention and cure of insulin resistance and type 2 diabetes.
24578384 CTRP3 promotes vascular calcification by enhancing phosphate-induced osteogenic transition of VSMC through reactive oxygen species-extracellular signal-regulated kinase 1/2-Runx2 pathway.
24417980 Patients with acute coronary syndrome or stable angina pectoris had significantly lower circulating CTRP-3 concentrations compared to controls.
24152681 Data suggest that serum/omental adipose tissue (AT) cartonectin levels are lower in women with polycystic ovary syndrome; treatment with a hypoglycemic agent (metformin) increases serum cartonectin levels in these women and in omental AT explants.
23174996 Data suggest that CTRP3 is expressed in subcutaneous and visceral adipocytes; CTRP3 appears to play important roles in adipocyte (epinephrine-induced) lipolysis, inflammation/infection, and adipokine/resistin secretion.
More...

AA Sequence

MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGN      1 - 70
NGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSV     71 - 140
ETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVL    141 - 210
KLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK                                      211 - 246
//

Text Mined References (31)

PMID Year Title
26997632 2016 Immunomodulatory roles of CTRP3 in endotoxemia and metabolic stress.
26656444 2016 C1q and tumor necrosis factor-related protein 3 is present in human cord blood and is associated with fetal growth.
26222183 2015 Lower Circulating C1q/TNF-Related Protein-3 (CTRP3) Levels Are Associated with Obesity: A Cross-Sectional Study.
26073386 Plasma CTRP-3 concentrations in Chinese patients with obesity and type II diabetes negatively correlate with insulin resistance.
25409499 2014 Low serum cartonectin/CTRP3 concentrations in newly diagnosed type 2 diabetes mellitus: in vivo regulation of cartonectin by glucose.
25185846 2014 CTRP3 improves the insulin sensitivity of 3T3-L1 adipocytes by inhibiting inflammation and ameliorating insulin signalling transduction.
24578384 2014 Overexpression of c1q/tumor necrosis factor-related protein-3 promotes phosphate-induced vascular smooth muscle cell calcification both in vivo and in vitro.
24417980 2014 Implications of C1q/TNF-related protein-3 (CTRP-3) and progranulin in patients with acute coronary syndrome and stable angina pectoris.
24152681 2013 Metformin increases the novel adipokine cartonectin/CTRP3 in women with polycystic ovary syndrome.
23174996 2012 The novel adipokine C1q/TNF-related protein-3 is expressed in human adipocytes and regulated by metabolic and infection-related parameters.
More...